SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024784 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024784
Domain Number 1 Region: 20-64
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000222
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024784   Gene: ENSMMUG00000018835   Transcript: ENSMMUT00000026479
Sequence length 352
Comment pep:known chromosome:MMUL_1:7:49856938:50056895:1 gene:ENSMMUG00000018835 transcript:ENSMMUT00000026479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVPQRMAAEGAPEDGGGGAPGVWGAWGPWSACSRSCSGGVMEQTRPCLPRSYRLRGSQRP
GTPTRAFADHVVSAVRTSVPLHRSGDKTPALAGTDASHQGPTTVVDGNKHGEPKKHKQPG
SSESRTRGPIGPGKYGYGKAPYILPLQTDTAHTPQRLRRQKPSSRHSRSQGASSARHGYS
SPAHQVPQHGPLYQSDSGPRSGLQAAEASIYQLPLTHDQGFPAASSLFHSPETSNNHGVG
THGATQSFSQPARSTAISCIGAYRQYKLCNTNVCPESSRSIREVQCASYNNKPFMGRFYE
WEPFAEVKGNRKCELNCQAMGYRFYVRQAEKVIDGTPCDQNGTAICVSGQCK
Download sequence
Identical sequences ENSMMUP00000024784 9544.ENSMMUP00000024784 ENSMMUP00000024784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]