SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024874 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024874
Domain Number 1 Region: 1-110
Classification Level Classification E-value
Superfamily POZ domain 1.41e-30
Family BTB/POZ domain 0.0021
Further Details:      
 
Domain Number 2 Region: 250-368
Classification Level Classification E-value
Superfamily Kelch motif 5.62e-23
Family Kelch motif 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024874   Gene: ENSMMUG00000018487   Transcript: ENSMMUT00000026579
Sequence length 376
Comment pep:known chromosome:MMUL_1:12:102005584:102016042:1 gene:ENSMMUG00000018487 transcript:ENSMMUT00000026579 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLEGLQRLRSQPKLADVTLLVGGRELPCHRGLLALSSPYFHAMFAGDFAESFSARVELRD
VEPAVVGQLVDFVYTGRLTITQGNVEALTRTAARLHFPSVQKVCGRYLQQQLDAANCLGI
CEFGEQQGLLGVAAKAWAFLRENFEAVAREDEFLQLPRDRLVTCLASDLLQVQPEQSRLE
ALLRWVRHDPQARASHLPELLSLVHLDAVPRPCVQQLLATEPLIQESEACRAALSQGHDG
APLALRQKLEEVLVVVGGRALEEDEAGEEPTPRLGNFAFYNSKAKRWMALPDFPDYHKWG
FSLAALNNNIYVTGGSRGTKTDTWSTTQAWCFPLKEAAWKPVAPMLKARTNHASAALNGE
IYAIGGTTLDVVEVES
Download sequence
Identical sequences ENSMMUP00000024874 9544.ENSMMUP00000024327 ENSMMUP00000024327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]