SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024923 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024923
Domain Number 1 Region: 221-311
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 3.14e-23
Family Thyroglobulin type-1 domain 0.00024
Further Details:      
 
Domain Number 2 Region: 40-137
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.77e-18
Family Growth factor receptor domain 0.0000582
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024923   Gene: ENSMMUG00000018940   Transcript: ENSMMUT00000026631
Sequence length 326
Comment pep:known chromosome:MMUL_1:12:80439650:80469062:1 gene:ENSMMUG00000018940 transcript:ENSMMUT00000026631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPRVGCPALPLPPPPLLPLLLLLLGASGGGGGGAHAEVLFRCPPCTPERLAACGPPPVA
PPAAVAAVAGGARMPCAELVREPGCGCCSVCARLEGEACGVYTPRCGQGLRCYPHPGSEL
PLQALVMGEGTCEKRRDAEYGASPEQVADNGDDHSEGGLVENHVDSTMNMLGGGGSAGRK
PLKSGMKELAVFREKVAEQHRQMGKGGKHHLGLEEPKKLRPPPARTPCQQELDQVLERIS
TMRLPDERGPLEHLYSLHIPNCDKHGLYNLKQCKMSLNGQRGECWCVNPNTGKLIQGAPT
IRGDPECHLFYNEQQEAHGVHTQRMQ
Download sequence
Identical sequences ENSMMUP00000024923 ENSMMUP00000024923 9544.ENSMMUP00000024923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]