SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024925 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024925
Domain Number 1 Region: 185-266
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 9.94e-26
Family Thyroglobulin type-1 domain 0.00013
Further Details:      
 
Domain Number 2 Region: 24-106
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.77e-24
Family Growth factor receptor domain 0.0000532
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024925   Gene: ENSMMUG00000018942   Transcript: ENSMMUT00000026633
Sequence length 272
Comment pep:known chromosome:MMUL_1:12:80483232:80499412:-1 gene:ENSMMUG00000018942 transcript:ENSMMUT00000026633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMLLTAVLLLLAAYAGPAQSLGSFVHCEPCDEKALSMCPPSPLGCELVKEPGCGCCMTCA
LAEGQSCGVYTERCAQGLRCLPRQDEEKPLHALLHGRGVCLNEKSYREQVKIERDSREHE
EPTTSEMAEETYSPKIFRPKHTRISELKAEAVKKDRRKKLTQSKFVGGAENTAHPRVISA
PEMRQESEQGPCRRHMEASLQELKASPRMVPRAVYLPNCDRKGFYKRKQCKPSRGRKRGI
CWCVDKYGMKLPGMEYVDGDFQCHTFDSSNVE
Download sequence
Identical sequences A0A0D9R9K7 A0A2K5JE03 A0A2K5P1D3 A0A2K5YY15 A0A2K6CHG1 A0A2K6PUQ7 F6YKJ0 G7PLE3
ENSMMUP00000024925 9544.ENSMMUP00000024925 NP_001270961.1.63531 XP_001087664.1.72884 XP_007964410.1.81039 XP_010360615.1.97406 XP_011738862.1.29376 XP_011787687.1.43180 XP_011819959.1.47321 XP_011918381.1.92194 ENSMMUP00000024925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]