SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024964 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024964
Domain Number 1 Region: 105-380
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 2.78e-116
Family Guanido kinase catalytic domain 0.0000000000568
Further Details:      
 
Domain Number 2 Region: 8-107
Classification Level Classification E-value
Superfamily Guanido kinase N-terminal domain 4.45e-43
Family Guanido kinase N-terminal domain 0.00000167
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024964   Gene: ENSMMUG00000018977   Transcript: ENSMMUT00000026674
Sequence length 381
Comment pep:known chromosome:MMUL_1:13:76401454:76402599:-1 gene:ENSMMUG00000018977 transcript:ENSMMUT00000026674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTG
VDNPGHPYIMTVGCVAGDEESYDVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDD
LDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMT
EAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISM
QKGGNMKEVFTRFCTGLTQIETLFKSKNYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLP
HLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLL
IEMEQRLEQGQAIDDLMPAQK
Download sequence
Identical sequences A0A0D9RZ81 A0A2K5NZM5 A0A2K5WBF5 A0A2K6D1K8 I0FP16
ENSMMUP00000024964 ENSMMUP00000024964 NP_001253960.1.72884 XP_008017582.1.81039 XP_011753248.1.29376 XP_011753249.1.29376 XP_011939491.1.92194 XP_015309724.1.63531 9544.ENSMMUP00000024964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]