SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024965 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024965
Domain Number 1 Region: 3929-4073
Classification Level Classification E-value
Superfamily CalX-like 6.28e-30
Family CalX-beta domain 0.0016
Further Details:      
 
Domain Number 2 Region: 1729-1815,1843-1903
Classification Level Classification E-value
Superfamily CalX-like 1.14e-29
Family CalX-beta domain 0.00053
Further Details:      
 
Domain Number 3 Region: 2235-2387
Classification Level Classification E-value
Superfamily CalX-like 1.2e-29
Family CalX-beta domain 0.0036
Further Details:      
 
Domain Number 4 Region: 2963-3091
Classification Level Classification E-value
Superfamily CalX-like 3.01e-28
Family CalX-beta domain 0.0024
Further Details:      
 
Domain Number 5 Region: 2120-2250
Classification Level Classification E-value
Superfamily CalX-like 8.63e-28
Family CalX-beta domain 0.0016
Further Details:      
 
Domain Number 6 Region: 1004-1133
Classification Level Classification E-value
Superfamily CalX-like 1.09e-27
Family CalX-beta domain 0.0024
Further Details:      
 
Domain Number 7 Region: 4403-4551
Classification Level Classification E-value
Superfamily CalX-like 1.7e-27
Family CalX-beta domain 0.0022
Further Details:      
 
Domain Number 8 Region: 2601-2718
Classification Level Classification E-value
Superfamily CalX-like 2.49e-27
Family CalX-beta domain 0.0019
Further Details:      
 
Domain Number 9 Region: 153-291
Classification Level Classification E-value
Superfamily CalX-like 4.97e-26
Family CalX-beta domain 0.0014
Further Details:      
 
Domain Number 10 Region: 4268-4399
Classification Level Classification E-value
Superfamily CalX-like 4.58e-24
Family CalX-beta domain 0.00096
Further Details:      
 
Domain Number 11 Region: 3587-3667
Classification Level Classification E-value
Superfamily CalX-like 6.54e-24
Family CalX-beta domain 0.0019
Further Details:      
 
Domain Number 12 Region: 774-927
Classification Level Classification E-value
Superfamily CalX-like 9.68e-24
Family CalX-beta domain 0.0038
Further Details:      
 
Domain Number 13 Region: 414-551
Classification Level Classification E-value
Superfamily CalX-like 2.35e-23
Family CalX-beta domain 0.0034
Further Details:      
 
Domain Number 14 Region: 1130-1281
Classification Level Classification E-value
Superfamily CalX-like 7.19e-23
Family CalX-beta domain 0.0039
Further Details:      
 
Domain Number 15 Region: 1312-1490
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.94e-22
Family Laminin G-like module 0.093
Further Details:      
 
Domain Number 16 Region: 5005-5133
Classification Level Classification E-value
Superfamily CalX-like 1.57e-21
Family CalX-beta domain 0.0023
Further Details:      
 
Domain Number 17 Region: 4052-4191
Classification Level Classification E-value
Superfamily CalX-like 2.22e-21
Family CalX-beta domain 0.0028
Further Details:      
 
Domain Number 18 Region: 4662-4800
Classification Level Classification E-value
Superfamily CalX-like 2.49e-21
Family CalX-beta domain 0.0054
Further Details:      
 
Domain Number 19 Region: 886-1003
Classification Level Classification E-value
Superfamily CalX-like 2.49e-20
Family CalX-beta domain 0.0046
Further Details:      
 
Domain Number 20 Region: 5222-5378
Classification Level Classification E-value
Superfamily CalX-like 3.79e-20
Family CalX-beta domain 0.0022
Further Details:      
 
Domain Number 21 Region: 1883-1988
Classification Level Classification E-value
Superfamily CalX-like 4.84e-20
Family CalX-beta domain 0.0021
Further Details:      
 
Domain Number 22 Region: 1990-2130
Classification Level Classification E-value
Superfamily CalX-like 7.59e-20
Family CalX-beta domain 0.0021
Further Details:      
 
Domain Number 23 Region: 3670-3815
Classification Level Classification E-value
Superfamily CalX-like 1.96e-18
Family CalX-beta domain 0.0066
Further Details:      
 
Domain Number 24 Region: 1499-1606
Classification Level Classification E-value
Superfamily CalX-like 3.34e-18
Family CalX-beta domain 0.0054
Further Details:      
 
Domain Number 25 Region: 2351-2396,2498-2576
Classification Level Classification E-value
Superfamily CalX-like 6.41e-18
Family CalX-beta domain 0.0026
Further Details:      
 
Domain Number 26 Region: 2706-2841
Classification Level Classification E-value
Superfamily CalX-like 3.27e-17
Family CalX-beta domain 0.0021
Further Details:      
 
Domain Number 27 Region: 2825-2960
Classification Level Classification E-value
Superfamily CalX-like 5.49e-17
Family CalX-beta domain 0.0026
Further Details:      
 
Domain Number 28 Region: 663-783
Classification Level Classification E-value
Superfamily CalX-like 9.29e-17
Family CalX-beta domain 0.0092
Further Details:      
 
Domain Number 29 Region: 3101-3208
Classification Level Classification E-value
Superfamily CalX-like 1.07e-16
Family CalX-beta domain 0.0054
Further Details:      
 
Domain Number 30 Region: 38-154
Classification Level Classification E-value
Superfamily CalX-like 4.19e-16
Family CalX-beta domain 0.0013
Further Details:      
 
Domain Number 31 Region: 264-399
Classification Level Classification E-value
Superfamily CalX-like 5.1e-16
Family CalX-beta domain 0.0055
Further Details:      
 
Domain Number 32 Region: 4173-4279
Classification Level Classification E-value
Superfamily CalX-like 0.00000000000000209
Family CalX-beta domain 0.0053
Further Details:      
 
Domain Number 33 Region: 5501-5655
Classification Level Classification E-value
Superfamily CalX-like 0.000000000000011
Family CalX-beta domain 0.0046
Further Details:      
 
Domain Number 34 Region: 3781-3912
Classification Level Classification E-value
Superfamily CalX-like 0.0000000000000196
Family CalX-beta domain 0.0028
Further Details:      
 
Domain Number 35 Region: 4538-4651
Classification Level Classification E-value
Superfamily CalX-like 0.000000000262
Family CalX-beta domain 0.0051
Further Details:      
 
Domain Number 36 Region: 5384-5510
Classification Level Classification E-value
Superfamily CalX-like 0.00000000183
Family CalX-beta domain 0.016
Further Details:      
 
Domain Number 37 Region: 515-629
Classification Level Classification E-value
Superfamily CalX-like 0.000000183
Family CalX-beta domain 0.01
Further Details:      
 
Domain Number 38 Region: 4763-4869
Classification Level Classification E-value
Superfamily CalX-like 0.000000235
Family CalX-beta domain 0.011
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000024965
Domain Number - Region: 3210-3251
Classification Level Classification E-value
Superfamily CalX-like 0.0167
Family CalX-beta domain 0.014
Further Details:      
 
Domain Number - Region: 5765-5832
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.085
Family Ricin B-like 0.034
Further Details:      
 
Domain Number - Region: 4904-4986
Classification Level Classification E-value
Superfamily CalX-like 0.0889
Family CalX-beta domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024965   Gene: ENSMMUG00000018976   Transcript: ENSMMUT00000026675
Sequence length 5957
Comment pep:known chromosome:MMUL_1:6:86850597:87096041:1 gene:ENSMMUG00000018976 transcript:ENSMMUT00000026675 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QKVFLNVGMPSASLLVNLLSALLILFVFGETEIRFTGQTEFVVNETSTTVIRLIIERIGE
PANVTAIVSLYGEDSGDFFDTYAAAFIPAGETNRTVYIAVCDDDLPEPDETFIFHLTLQK
PSANVKLGWPRTVTVTILSNDNAFGIISFNMLPSVTVSEPRGRNESVPLTLIREKGTYGM
VMVTFEVEGGPNSPDEDLSPVKGNITFPPGRATVIYNLTVLDDEVPENDEVFLVQLKSVE
GGAEINTSRNSVEIIIKKNDSPVRFLQSIYLVPEEDHILVIPVVRGKDNNGNLIGSDEYE
VSISYAIATGNSTAHAQQNLDFIDLQPNTTVVFPPFIHESHLKFQIVDDTIPEIAESFHI
MLLKDTLQGDAVLISPSVVQVTIKPNDKPYGVLSLNSVLFERIVIIDEDRISRFEEITVV
RNGGTHGNVSVNWVLTRNSSDPSPVTADITPSSGVLHFAQGQMLATVPLTVVDDDLPEEA
EAYLLQILPHTIRGGAEVSEPAELLFYIQDSDDVYGLITFFPMENQKIESSPGERHLSLS
FTRLGGTKGDVRLLYSVLYIPAGAVDPLQAKDGILNISRRNDLTFPEQKTQVTTKLPIRN
DAFLQNGAHFLVQLETVELLNIIPPIPPISPRFGEICNISLLVTPAIANGEIGLLSNLPI
ILHEPEDFAAEVVYIPLHRDGTDGQATVYWSLKPSGFNSKAVTPDDIGPFNGSVLFLSGQ
SDTTINITVKGDDIPEMNETVTLSLDRVNVENQVLKSGYTSCDLIILENDDPGGVFEFSP
ASRGPYVIKEGESVELHIIRSRGSLVKQFLHYRVEPRDSNEFYGNTGVLEFKPGEREIVI
TLLARLDGIPELDEHYWVVLSSHGDRESKLGSATIVNITILNNDDPHGIIEFVSDSLIVM
INESKGDDIYSAVYDVVRNRGNFGDVSVSWLVSPDFTQDVFPVQGTIVFGDQEFSKNITI
YSLPDEIPEEMEEFTILLLNATGGAKVGNRTTATLRIRRNDDPIYFAEPRVVRVQEGETA
NFTVLRNGSVDVTCTVQYATMDGKATARARDFIPVEKGEMLIFEVGSREQSISIFVNEDG
IPEMDESFYIILFNSTGDTVVYQYGVATVIIEANDDPNGIFSLEPIDKAVEEGKTNAFWI
LRHRGCFGSVSVSWQLFQNDSALQPGQEFYETSGTVNFMDGEEAKPIILHAFPDKIPEFN
EFYILKLVNISGGSPGPGGQLAETNLQVTVMIPFNDDPFGVFILDPECLEREVAEDVLSE
DDMSYITNFTILRQQGVFGDVRLGWEILSSEFPAGLPPMIDFLLVGIFPTTVHLQQHMRR
HHSGTDALYFTGLEGAFGTVNPKYHPFRNNTIANFTFSAWVMPNANTNGFIIAKDDGNGS
IYYGVKIQSNESHVTLSLHYKTLGSNATYIAKATVMKYLEESMWLHLLIILDDGIIEFYL
DGNAMPRGIKSLKGEAITDGPGILRIGAGINGNDRFTGLMQDVRSYERKLTLEEIYELHA
MPAKSDLHPVSGYLEFRQGETNKSFIISARDDNDEEGEELFILKLVSVYGGACISEENTT
ARLIIQKSDNANGLFGFTGACIPEIAEEGSTISCVVERTRGALDYVHVFYTISQIETDGI
NYLVDDFANASGTITFLPWQRSEEPRILNGSLLISHLKEIFDYFKIRLKCTLKAKFKFEL
RSSEPKSLEKEQQTLDTENATAQHSFGLLQFSTGLPPQPEDTMTLPASSVPHITVQEEDG
EIRLLVIRAQGLLGRVTAEFRTVSLTAFSPEDYQNVAGTLEFQPGERYKYISVNITDNSI
PELEKSFKVELLNLEGGVAELFRVDGSGSGDGDMEFLLPTIHKHASLGVASQILVTIAAS
DHAHGVFEFSPESLFVSGTEPEDGYSTVILNVIRHYGTLSPVTLHWNIDSDPDGDLAFTS
GNITFEIGQTSANITVEILPDEDPELDKAFSVSILSVSSGSLGAHVNATLTVLASDDPYG
VFIFSEKNRPVKVEEATQNITLSIIRLKGLMGKVLVSYATLDDMEKPPYFPPNLARATQG
RDYIPASGFALFRANQSEATIAISILDDDEPERSESVFIELLNSTLMAKVQSRSIPNSPR
LGPKVETVAQLIIIANDDAFGTLQLSAPIVRVAENHVGPIINVTRTGGAFADVSVKFKAV
PITAIAGEDYSIASSDVVLLEGETSKAVPIYIINDIYPELEESFLVQLLNETTGGARLGA
LTEAVIIIEASDDPYGLFGFQITNLIVEEPEFNSVKVNLPIIRNSGTLGNVTVQWVATIN
GQLATGDLRVVSGNVTFAPGETIQTLLLEVLADDVPEIEEVIQVQLTDASGGGTIGLDRI
ANIIIPANDNPYGAVAFVQKVYRVQEPLERSSCANITVRRSGGHFGQLLLFYSTSDIDVV
ALAMEEGQDLLSYYESPIQGVPDPLWRTWVNVSVGGEPQYTCATLCLKEQACSAFSFFSA
SEGPQCVWMTSWISPAVNSSDFWTYRKNMTRVASLFSGQAVAGSDYEPVTRQWAIMQEGD
EFANLTVSILPDDFPEMDESFLISLLEVHLMNISTSVKNQPTIGQPNTSTVVIALNGDAF
GVFVIYSISPNTSEDGLFVEVQEQPQTLVEMMIHRTGGSLGQVAVEWRVVGGTATEGLDF
IGAGEILTFAEGETKKTVILTILDDSEPEDDESIIVSLVYTEGGSRILPSSDTVRVNILA
NDNVAGIVSFQTASRSVIGHEGEILQFHVIRTSPGRGNVTVNWKIIGQNLELNFANFSGQ
LFFPEGSLNTTLSVHLLDDNIPEEKEVYQVILYDVRTQGVPPAGIALLDAQGYAAVLTVE
ASDEPHGVLNFALPSRFVLLQEANITIQLFINREFGSLGAINVTYTTVPGMLSLKNQTVG
NLAEPEVDFVPVIGFLILEEGETAAAINITILEDDIPELEEYFLVNLTYVELIMAASTSF
PPRLDSEGLTAQIIIDANDGARGVIEWQHSRFEVNETHGSLTLVAQRNREALGHVSLFVY
AQNLEAQLGLDYIFTPMILHFADGERYKNVNIMILDDDIPEGDEKFQLILTNPSPGLELG
KNTIALIIVLANDDGPGVLSFNNSEHFFLREPTALYIQESVAVLYIVREPAQGLFGTVTV
QFIVTEVNSSNESKDLTPSKGYIVLKEGIRFKALHISAILDTEPEMDEYFVCTLFNPTGG
ARLGARVQTLITVLQNQAPLGLFSISAVENSATSIDIEEANRTVYLNVSRTNGIGLAVSV
QWETVSETAFGMRGMDVVFSVFQSFLDESASGWCFITLGNLIYGIMLRKSSVTVYRWQGI
FIPVEDLNIENPKTCEAFNIGFSPYFVITHEERNEEKPSLNSVYTFTSGFKLFLVQTIVI
LESSQVRYFTSDSQDYLIIASQRDDSELTQVFRWNGGSFVLHQKLPVRGVLTVALFNKGG
SVFLAISQANARLNSLLFRWSGIGFINFQEVPIIGTTQVEALSSANDIYLIFAKNVFLGD
QNSIDIFVWEMGQSSFRYFQSLDFAAVNGIHSFTPASGIAHILLIGQNMSALYCWNSELN
QFSFVLEVPSAYDVASVTVKSLNSSKNLIALVGAHSHIYELAYISSHSDFIPSSGELMFE
PGDREATIAVNILDDTVPEKEESFKVQLKNPKGGAEIGINDSVTITILSNDDAYGIVAFA
QNSLYKQVEEMEQDSLVTLNVERLKGTYGRITVAWEADGSISDIFPTSGVISFTEGQVLS
TITLTILADNIPELSEVVIVTLTHITTEGVEDSYKGATIDQDRSKSVITTLPSDSPFGLV
GWHAVSVFIRVAEPKENTTTLQLQIARDKGLLGDIAIHLRAKPNFLLHVDNQATENEDYI
LQETIIIMKENVKEAHAKVSILPDDIPELEEGFIVTITEVNLVNSDFSAGQPSVRRPGME
VAEIMIEENDDPRGIFMFHVTRGAGEVITAYEVPPPLNVLQVPVVRLAGSFGAVNVYWKA
SPDSAGLEDFKPSHGILEFADRQVTAVIEMTIIDDAEFELTETFNISLISVAGGGRLGDD
VVVTVVIPQNDSPFGVFGFEEKTVMIDESLSSDDPDSYVTLTVVRSPGGKGTVRLQWTID
EKAKHDLSPLNGTLHFDETESQKTIVLHTLQDTVLEEDRRFTIQLISIDEAEISPVKGSA
SIIIRGDKRASGEVGIAPSSRHILIGEPSAKYNGTAIISLVRGPGILGAVTVFWRIFPPS
MGEFAETSGKLTMRDGQSAVIVVIQALNDDIPEEKSFYEFQLTAISEGGVLSESSSTANI
TMVASDSPYGRFAFLHEQLRVSEAQRVNITIIRSGGAFGRVRLWYEWMSGTAEAGLDFVP
AAGELLFEAGEMKKSLQVEILDDDHPEGPEEFSLTITKVELQGRGYDFTIQENGLQIDQP
PEIGNISIVRIMIMKNDNAEGIIEFDPKYTAFEVEEDVGLIMIPVVRLHGTYGYVTADFI
SQSSSASPGGVDYILHDSTVTFQHGQNLSFINISIIDDNESEFEEPIEILLTGATGGAVL
GRHLVSRIIIAKSDSPFGVVRFLNQSKISVPNPNSTMILSLVLERTGGLLGEIQVNWEIV
GPNSQEALLPQNGDIADPVSGLFSFREGEGGVRTIILTIYPHEEIEVEETFIIKLHLVKG
EAKLDSRAKDVTLTIQKFGDPNGVVQFAPETLSKKTYSEPLALEGPLLITFFVRRVKGTF
GEITVYWELSSKFDITEDFLFTNGFFAIADGESEASFGVHLLPDEVPEIEEDYMIQLVSV
EGGAELDLEKSITWFSVYANDDPHGIFALYSDRQSILIGQNLIRSIQINITRLAGTFGDV
AVGLRISSDHKEQPIVTENTERQLVVKDGATYKVDMVPIKNQVFLSLGSNFTLQLVTVML
VGGRFYGMPFFFQEAKSAVLPVSEKAAISKQVGFDSTAFQLMNITAGTSHVMISRRGTYG
ALSVAWTTGYAPGLEIPEFIVVGNMTPTLGSLSFSHGEQRKGVFLWTFPSPGRPEAFVLH
LSGVQSSAPGGAQLRSGFIVAEIEPMGIFQFSSSSRNIMVSEDTQMIRLHVQRLFGFHSD
LIKVSYQTTAGSAKPLEDFEPVQNGELFFQKFQTEVDFEITIINDQLSEIEEFFYINLTS
VEIRGLQKFDVSWSPRLNLDFSVAVITILDNDDLAGMDVSFPVTTVAVAVDTTLIPVETE
STTYFGTSKTTTILQPTNVVAIVTEATGVSAIPEKLVTLHGTPAVSEKPDVATVTANVSI
HGTFSLGPSIVYVEEEMKNGIFNTAEVLIRRTGGFTGNVSITVKTFGERHAQKEPNALPF
HGIYGISNLTWAVEEEDFEEQTLTLIFLDGERERKVSVQILDDDEPEGQEFFYVFLTNPQ
GGAQIVEGKDDTGFAAFAMVIITGSDIHNGIIGFSEESQSGLELREGADMRRLQLIVTRQ
PNRAFEDVKVFWRVTLNKTVVVLQKDGVNLVEELRSVSGTTTCTTGQTKCFISIELKPEK
IPQVEVYFFVELYEATAGAAINNSARFAQIKILQSDESQSLVYFSVGSRLAVAHKKATLI
SLQVARDSGTGLMMSVNFSTQELRSAETIGRTIISPAISGKDFVITKGTLVFEPGQRSTV
LDVILTPETGSLNSFPKRFQIVLFDPKGGARIDKVYGTANITLVSDADSQAIWGLADQLH
QPVNDDILNRVLHTISMKVATENTDEQLSAMMHLIEKITTEGKNQAFSVASRTLFYEILC
SLINPKRKDTRGFSHFTEVTENFAFSLLTNVTCGSPGEKGKTILDSCPYLSILALHWYPQ
QINGHKFEGKEGDYIRIPERLLDIQDAEIMAGKSTCKLVQFTEYSSQQWFISGNNLLTLK
NKVLSLSVKGQSSQLLTNDNEVLYRIHAAEPRIIPQTSLCLLWNQAAASWLSDSQFCKVV
EETADYVECACSHMSVYAVYAQTDNLSSYNEAFFTSGFICISGLCLAVLSHIFCARYSMF
AAKLLTHMMAASLCTQV
Download sequence
Identical sequences ENSMMUP00000024965 ENSMMUP00000024965 9544.ENSMMUP00000024965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]