SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024971 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024971
Domain Number 1 Region: 119-159
Classification Level Classification E-value
Superfamily WW domain 0.000000000000757
Family WW domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024971   Gene: ENSMMUG00000018982   Transcript: ENSMMUT00000026682
Sequence length 400
Comment pep:known chromosome:MMUL_1:2:138131822:138274885:1 gene:ENSMMUG00000018982 transcript:ENSMMUT00000026682 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPASAPPPLPPPGQQVIHVTQDLDTDLEALFNSVMNPKPSSWRKKILPESFFKEPDSGS
HSRQSSTDSSGGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGSPAQQHAHLRQQSYDV
TDELPLPPGWEMTFTATGQRYFLNHIEKITTWQDPRKAMNQPLNHMNLHPAVSSTPVPQR
SMAVSQPNLVMNHQHQQQMAPSTLSQQNHPTQNPPAGLMSMPNALTTQQQQQQKLRLQRI
QMERERIRMRQEELMRQVWPSMVGSPASASQVAGTTGACHHARLTFDMYFKIKTFLPPQP
GKGPYHSREQSTDSGLGLGCYSVPTTPEDFLSNVDEMDTGENAGQTPMNINPQQTRFPDF
LDCLPGTNVDLGTLESEDLIPLFNDVESALNKSEPFLTWL
Download sequence
Identical sequences ENSMMUP00000024971 ENSMMUP00000024971 9544.ENSMMUP00000024971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]