SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024992 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024992
Domain Number 1 Region: 482-647,696-759
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.96e-72
Family Protein kinases, catalytic subunit 0.00000907
Further Details:      
 
Domain Number 2 Region: 1-26
Classification Level Classification E-value
Superfamily UBA-like 0.00000000689
Family UBA domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024992   Gene: ENSMMUG00000019006   Transcript: ENSMMUT00000026709
Sequence length 760
Comment pep:known scaffold:MMUL_1:1099548049550:28211:39851:1 gene:ENSMMUG00000019006 transcript:ENSMMUT00000026709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QEMAGRALKQTGSRSIEAALEYISKMGYLDPRNEQIVRVIKQTSPGKGLMPAPVTRRPSF
EGTSDSFASYHQLSGAPYEGPSFGADGPAALEEVPRPYVDYLFPGVGPHGPGHQHQHQHP
PKGYGAGVEAAGAHFPLQGTHYGRPHLLVHGEPLGYGQAGPTAHQLHVLGSRSQVFAGDS
PPQSLLTPSRNSLNVDLYDLGSTSVQQWPAATLARRDSLQKPGLEAPPRAHVAFRPDCPV
PSRTNSFNSHQPRPGAPGKAEPSLPAPNTVTAVTAAHILHPVKSVRVLRPEPQTAVGPSH
PAWVPAPAPAPAPATEGLDAKEEHALALGGAGAYPLDVEYGGPDRRCPPPPYPKHLLLRS
KSEQYDLDSLCAGVEQSLRAGPSEPEGGEKSRKSAKGDKGGKDKKQIQTSPVPVRKNSRD
EEKRESRIKSYSPYAFKFFMEQHVENVIKTYQQKVNRRLQLEQEMAKAGLCEAEQEQMRK
ILYQKESNYNRLKRAKMDKSMFVKIKTLGIGAFGEVCLACKVDTHALYAMKTLRKKDVLN
RNQVAHVKAERDILAEADNEWVVKLYYSFQDKDSLYFVMDYIPGGDMMSLLIRMEVFPEY
LARFYIAELTLAIESVHKMGFIHRDIKPDNILIDLDGHIKLTDFGLCTGFRWTHNSKYYQ
KGSHVRQDSMEPSDLWDDVSNCRCGDRLKTLEQRARKQHQRCLAHSLVGTPNYIAPEVLL
RKGYTQLCDWWSVGVILFEMLVGQPPFLAPTPTETQLKVI
Download sequence
Identical sequences ENSMMUP00000024992 ENSMMUP00000024992 9544.ENSMMUP00000024992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]