SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025004 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025004
Domain Number 1 Region: 14-153
Classification Level Classification E-value
Superfamily PX domain 0.00000000000801
Family PX domain 0.011
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000025004
Domain Number - Region: 278-384
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0119
Family BAR domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025004   Gene: ENSMMUG00000019017   Transcript: ENSMMUT00000026722
Sequence length 392
Comment pep:known chromosome:MMUL_1:14:8600892:8605108:-1 gene:ENSMMUG00000019017 transcript:ENSMMUT00000026722 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPSCASVDLQGDSSLQVEISDAVSERDKVKFTVQTKSCLPHFAQTEFSVVRQHEEFIWLH
DAYVENEEYAGLIIPPAPPRPDFEASREKLQKLGEGDSSVTREEFAKMKQELEAEYLAIF
KKTVAMHEVFLQRLAAHPTLRRDHNFFVFLEYGQDLSVRGKNRKELLGGFLRNIVKSADE
ALITGMSGLKEVDDFFEHERTFLLEYHTRIRDACLRADRVMRAHKCLADDYIPISAALSS
LGTQEVNQLRTSFLKLAELFERLRKLEGRVASDEDLKLSDMLRYYMRDSQAAKDLLYRRL
RALADYENANKALDKARTRNREVRPAESHQQLCCQRFERLSDSAKQELMDFKSRRVSSFR
KNLIELAELELKHAKASTLILRNTLVALKGEP
Download sequence
Identical sequences ENSMMUP00000025004 9544.ENSMMUP00000025004 ENSMMUP00000025004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]