SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025022 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025022
Domain Number 1 Region: 253-402,467-533,573-740
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.02e-47
Family Quinoprotein alcohol dehydrogenase-like 0.027
Further Details:      
 
Domain Number 2 Region: 705-848
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000000152
Family WD40-repeat 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025022   Gene: ENSMMUG00000019032   Transcript: ENSMMUT00000026743
Sequence length 850
Comment pep:known chromosome:MMUL_1:19:52058971:52096994:-1 gene:ENSMMUG00000019032 transcript:ENSMMUT00000026743 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLERRALLWQREAGPGGGDRARAGTGGAGGGCGGTMAERGPAFCGLYDTSSLLQYCNDDN
LSGTSGMEVDDRVSALEQRLQLQEDELAVLKAALADALRRLRACEEQGAALRARGTPKGR
APPRLGTTASVCQLLKGLPTRTPLNGSGPPRRVGGYATSPSSPKKEATSGRSSVRRYLSP
ERLASVRREDPRSRTTSSSSNCSAKKEGKTKEVIFSVEDGSVKMFLRGRPVPMLIPDELA
PTYSLDTRSELPSCRLKLDWVYGYRGRDCRANLYLLPTGEIVYFVASVAVLYSVEEQRQR
HYLGHNDDIKCLAIHPDMVTIATGQVAGTTKEGKPLPPHVRIWDSVSLSTLHVLGLGVFD
RAVCCVGFSKSNGGNLLCAVDESNDHMLSVWDWAKETKVVDVKCSNEAVLVATFHPTDPT
VLITCGKSHIYFWTLEGGSLSKRQGLFEKHEKPKYVLCVTFLEGGDVVTGDSGGNLYVWG
KGGNRITQAVLGAHDGGVFGLCALRDGTLVSGGGRDRRVVLWGSDYSKLQEVEVPEDFGP
VRTVAEGHGDTLYVGTTRNSILQGSMHTGFSLLVQGHVEELWGLATHPSQAQFVTCGQDK
LVHLWSSESHQPLWSRIIEDPARSAGFHPSGSVLAVGTVTGRWLLLDTETHDLVAIHTDG
NEQISVVKFSPDGAYLAVGSHDNLVYVYTVDQGGRKVSRLGKCSGHSSFITHLDWAQDSS
CFVTNSGDYEILYWDPATCKQITSADAVRNMEWATATCVLGFGVFGIWSEGADGTDINAV
ARSHDGKLLASADDFGKVHLFSYPCCQPRALSHKYGGHSSHVTNVAFLWDDSMALTTGGK
DTSVLQWRVV
Download sequence
Identical sequences 9544.ENSMMUP00000025022 ENSMMUP00000025022 ENSMMUP00000025022 XP_001110928.2.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]