SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025049 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025049
Domain Number 1 Region: 48-344
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 7.74e-75
Family Pancreatic lipase, N-terminal domain 0.00000606
Further Details:      
 
Domain Number 2 Region: 346-483
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 7.04e-24
Family Colipase-binding domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025049   Gene: ENSMMUG00000019054   Transcript: ENSMMUT00000026772
Sequence length 500
Comment pep:known chromosome:MMUL_1:18:42602940:42628540:1 gene:ENSMMUG00000019054 transcript:ENSMMUT00000026772 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNSVPLLCFWSLCCCFAAGSPTPFGPEGQLADELHKPKAIQTEVKPSVRFNLRTSKDPE
HEGCYLSLGHSQPLEDCGFNMTAKTFFIIHGWTMSGIFENWLHKLVSALHTREKDANVVV
VDWLPLAHQLYTDAVNNTRVVGHSIARMLDWLQEKDDFSLGNVHLIGYSLGAHVAGYAGN
FVKGTVGRITGLDPAGPMFEGADIHKRLSPDDADFVDVLHTYTRSFGLSIGIQMPVGHID
IYPNGGDFQPGCGLNDVLGSMAYGTITEVVKCEHERAVHLFVDSLVNQDKPSFAFQCTDS
NRFKKGICLSCRKNRCNSIGYNAKKMRNKRNSKMYLKTRAGMPFRVYHYQMKIHVFSYKN
MGEIEPTFYVTLYGTNADSQTLPLEIVERIEQNATNTFLVYTEEDLGDLLKIQLTWEGAS
QSWYNLWKELRSYLSQPHNPGRELNIRRIRVKSGETQRKLTFCAEDPENTSISPGRELWF
RKCRDGWRMKNETSPTVELP
Download sequence
Identical sequences A0A1D5RH04 G8F3E1
9544.ENSMMUP00000025049 ENSMMUP00000025049 XP_001090086.1.72884 XP_005586791.1.63531 ENSMMUP00000025049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]