SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025051 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025051
Domain Number 1 Region: 532-648
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.82e-30
Family UBX domain 0.0000178
Further Details:      
 
Domain Number 2 Region: 333-485
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000183
Family UAS domain 0.086
Further Details:      
 
Domain Number 3 Region: 88-176
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000155
Family Ubiquitin-related 0.022
Further Details:      
 
Domain Number 4 Region: 186-257
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000518
Family Ubiquitin-related 0.043
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000025051
Domain Number - Region: 6-42
Classification Level Classification E-value
Superfamily UBA-like 0.00561
Family TAP-C domain-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025051   Gene: ENSMMUG00000019056   Transcript: ENSMMUT00000026774
Sequence length 650
Comment pep:known chromosome:MMUL_1:1:53269481:53780614:-1 gene:ENSMMUG00000019056 transcript:ENSMMUT00000026774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASNMDREMILADFQACTGIENIDEAITLLEQNNWDLVAAINGVIPQENGILQSEYGGET
IPGPAFNPASHPASAPTSSSSSAFRPVMPSRQIVERQPRMLDFRVEYRDRNVDVVLEDSC
TVGEIKQILENELQIPVSKMLLKGWKTGDVEDSTVLKSLHLPKNNSLYVLTPDLPPPSSS
SHSGALQESLNQNFMLIITHREVQREYNLNFSGSSTIQEVKRNVYDLTSIPVRHQLWEGW
PTSATDDSMCLAESGLSYPCHRLTVGRRSSPAQTREQSEEQSTDVHMVSDSDGDDFEDAT
EFGVDDGEVFGMASSALRKSPMMPENAENEGDALLQFTAEFSSRYGDCHPVFFIGSLEAA
FQEAFYVKARDRKLLAIYLHHDESVLTNVFCSQMLCAESIVSYLSQNFITWAWDLTKDSN
RARFLTMCNRHFGSVVAQTIRTQKTDQFPLFLIIMGKRSSNEVLNVIQGNTTVDELMMRL
MAAMEIFTAQQQEDIKDEDEREARENVKREQDEAYRLSLEADRAKREAHEREMAEQFRLE
QIRKEQEEEREAIRLSLEQALPPEPKEENAEPVSKLRIRTPSGEFLERRFLASSKLQIVF
DFVASKGFPWDEYKLLSTFPRRDVTQLDPNKSLLEVKLFPQETLFLEAKE
Download sequence
Identical sequences A0A2K5J0U6 A0A2K5UXJ1 I0FK88
ENSMMUP00000025051 NP_001252796.1.72884 XP_011781635.1.43180 XP_011781636.1.43180 XP_015291593.1.63531 XP_015291601.1.63531 9544.ENSMMUP00000025051 ENSMMUP00000025051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]