SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025108 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025108
Domain Number 1 Region: 2-94
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.31e-30
Family PWWP domain 0.0000122
Further Details:      
 
Domain Number 2 Region: 482-516
Classification Level Classification E-value
Superfamily HIV integrase-binding domain 0.00000000615
Family HIV integrase-binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025108   Gene: ENSMMUG00000028925   Transcript: ENSMMUT00000026833
Sequence length 639
Comment pep:known chromosome:MMUL_1:19:4339156:4373509:1 gene:ENSMMUG00000028925 transcript:ENSMMUT00000026833 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPHAFKPGDLVFAKMKGYPHWPARIDDIADGAVKPPPNKYPIFFFGTHETAFLGPKDLFP
YDKCKDKYGKPNKRKGFNEGLWEIQNNPHASYSAPPALESAHSSFPHSNPQSGPDVDEQN
ETQGVAQMTAGEGHAQSSQLPDGAAEAQSRSQVVKRKTPSLVLAVSWTSCMPHSSLSHAI
LSSHQENGENVSFKNLNFSLSLSSQKKQLLRKEPVMCLAHRKHEKAPSASDSDSKADSDG
AKPETVAVARSADSDVSVKKPPRGRKPAEKPPPKPRGRKPKPERPPSSSSSDSDSDEVDR
ISEWKRRDEARRRELEARRRREQEEELRRLREQEKEEKERRRERAERGEAERGSGGSSGD
ELREDDEPVKKRGRKGRGRGPPSSSDSEPEAELEREAKKSAKKLQSPSTEPARKPGQKEK
RARPEEKPQAKPVKVERTRKRSEGFSMDRKVEKKKGEAWLPSTAHTEFAEGNGDSHGVAG
LSCNTDVVATLKKIRRYKANKDVMEKAAEVYTRLKSRVLGPKIEAVQKANKAGTEKEKAE
EKLAGEELAGEEAPQEKAEDKPSTDLSAPVNGEATSQKGESVEDKEHEEGRDSEEGPRCG
SSEDLHDSLREGPDLDRPGSDRQERERARGDSEALDEES
Download sequence
Identical sequences 9544.ENSMMUP00000025108 ENSMMUP00000025108 ENSMMUP00000025108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]