SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025118 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025118
Domain Number 1 Region: 112-241
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.07e-43
Family UAS domain 0.000000215
Further Details:      
 
Domain Number 2 Region: 360-469
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.47e-28
Family UBX domain 0.00000137
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000025118
Domain Number - Region: 2-33
Classification Level Classification E-value
Superfamily UBA-like 0.0145
Family TAP-C domain-like 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025118   Gene: ENSMMUG00000019100   Transcript: ENSMMUT00000026843
Sequence length 470
Comment pep:known chromosome:MMUL_1:2:189031681:189086029:1 gene:ENSMMUG00000019100 transcript:ENSMMUT00000026843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TVSGASESVGKHMLEACNNNLEMAVTMFLDGGGIAEEPSTSSASVSAVRPHTEEEVRAPI
PQKQEILVEPEPLFGAPKRRRPARSIFDGFRDFQTETIRQEQELRNGGAIDKKLTTLANL
FRPPIDLMHKGSFETAKECGQMQNKWLMINIQNVQDFACQCLNRDVWSNEAVKNIIREHF
IFWQVYHDSEEGQRYIQFYKLGDFPYVSILDPRTGQKLVEWHQLDVSSFLDQVTGFLGEH
GQLDGLSSSPPKKCARSESLIDASEDSQLEAAIRASLQETHFDSTQTKQDSRSDEESESE
LFSGSEEFISVCGSDEEEEVENLAKSRKSPHKDLGHRKEENRRPLTEPPVRTDPGTGTAT
NHQGLPAVDSEILEMPPEKSDGVVEGIDVNGPKAQLMLRYPDGKREQITLPEQAKLLALV
KHVQSKGYPNERFELLTNFPRRKLSHLDYDITLQEAGLCPQETVFVQERN
Download sequence
Identical sequences 9544.ENSMMUP00000025118 ENSMMUP00000025118 ENSMMUP00000025118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]