SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025169 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025169
Domain Number 1 Region: 297-588
Classification Level Classification E-value
Superfamily Kelch motif 5.62e-57
Family Kelch motif 0.00036
Further Details:      
 
Domain Number 2 Region: 29-142
Classification Level Classification E-value
Superfamily POZ domain 1.41e-31
Family BTB/POZ domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025169   Gene: ENSMMUG00000019149   Transcript: ENSMMUT00000026901
Sequence length 594
Comment pep:known chromosome:MMUL_1:8:126220073:126227113:-1 gene:ENSMMUG00000019149 transcript:ENSMMUT00000026901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSVTLHSINKSRNLPGQIICQLNDQRATPPECHLWQLNSLRQSRILTDVSICAGAREIPC
HRNVLASSSPYFRAMFCSSFREKSEAKVQLKGIDPPTLDQIVSYVYTGEARIDADNVLPV
MEAASMLQFPKLFEACSSYLQSQLAPSNCLGMIRLSEILSCETLKKKAREVALTSFPEVA
ASADLKELCALELRDYLGDDGLCGEEEKVFEALMVWIKHDHQARKRYMQELFKQVRLQYI
HPAFFQHFIANDALLQSSPACQLILETAKRQMFSLCGTSAPDCKLLLHVPPRNSYQDFLI
LLGGRKDSQQTTRDVLLYSKQTGQWQSLAKLPTRLYKASAVTLHRSVYVLGGMAVSSGRS
LVSHNVYIFSLKLNQWRLGEPMLVARYSHRSTAHKNFIFSIGGIGEGQELMGSMERYDSI
CNVWESMASMPVGVLHPAVAVKDQRLYLFGGEDIMQNPVRLIQQNCHRPSENKITAKEPA
PFSWVFLPFLMLHFSRTVMTFSNRYTRRILAYDPQSNKFVKCADMKDRRMHHGATVMGNK
LYVTGGRRLTTDCNIEDSASFDCYDPETDTWTSQGQLPHKLFDHACLTLQCIPR
Download sequence
Identical sequences ENSMMUP00000025169 ENSMMUP00000031952 9544.ENSMMUP00000031952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]