SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025183 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025183
Domain Number 1 Region: 417-694
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.69e-79
Family Protein kinases, catalytic subunit 0.0000000414
Further Details:      
 
Domain Number 2 Region: 864-1006
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 9.42e-58
Family FAT domain of focal adhesion kinase 0.00000707
Further Details:      
 
Domain Number 3 Region: 138-256
Classification Level Classification E-value
Superfamily Second domain of FERM 7.98e-42
Family Second domain of FERM 0.0000203
Further Details:      
 
Domain Number 4 Region: 37-137
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.2e-34
Family First domain of FERM 0.00035
Further Details:      
 
Domain Number 5 Region: 261-366
Classification Level Classification E-value
Superfamily PH domain-like 8.97e-31
Family Third domain of FERM 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025183   Gene: ENSMMUG00000019159   Transcript: ENSMMUT00000026917
Sequence length 1009
Comment pep:known chromosome:MMUL_1:8:27471134:27609237:1 gene:ENSMMUG00000019159 transcript:ENSMMUT00000026917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGVSEPLSRVKVGTLRRPEGPAEPMVVVPVDVEKEDVRILKVCFYSNSFNPGKNFKLVK
CTVQTEIREIITSILLSGRIGPNIQLAECYGLRLKHMKSDEIHWLHPQMTVGEVQDKYEC
LHVEAEWRYDLQIRYLPEDFMESLKEDRTTLLYFYQQLRNDYMQRYASKVSEGMALQLGC
LELRRFFKDMPHNALDKKSNFELLEKEVGLDLFFPKQMQENLKPKQFRKMIQQTFQQYAS
LREEECVMKFFNTLAGFANIDQETYRCELIQGWNITVDLVIGPKGIRQLTSQDAKPTCLA
EFKQIRSIRCLPLEEGQAVLQLGIEGAPQALSIKTSSLAEAENMADLIDGYCRLQGEHQG
SLIVHPRKDGEKRNSLPQIPMLNLEARRSHFSESCSIESDIYAEIPDETLRRPGGSQYGI
AREDVVLNRILGEGFFGEVYEGVYTNHKGEKINVAVKTCKKDCTLDNKEKFMSEAVIMKN
LDHPHIVRLIGIIEEEPTWIIMELYPYGELGHYLERNKNSLKVLTLVLYSLQICKAMAYL
ESINCVHRDIAVRNILVASSECVKLGDFGLSRYIEDEDYYKASVTRLPIKWMSPESINFR
RFTTASDVWMFAVCMWEILSFGKQPFFWLENKDVIGVLEKGDRLPKPDLCPPVLYTLMTR
CWDYDPSDRPRFTELVCSLSDIYQMEKDIAMEQERNARYRTPKILEPTAFQEPPPKPSRP
KYRLPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMR
EEDFIRPSSREEAQQLWEAEKIKMRQILDKQQKQMVEDYQWLRQEEKSLDPMVYMNDKSP
LTPEKEVGYMEFTGPPQKPPRLGAQSIQPTANLDRTDDLVYLNVMELVRAVLELKNELCQ
LPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLA
QQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAHPPAE
Download sequence
Identical sequences A0A1D5R267
XP_015000506.1.72884 ENSMMUP00000025183 ENSMMUP00000025183 9544.ENSMMUP00000025183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]