SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025207 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025207
Domain Number 1 Region: 166-495
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 5.72e-58
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000228
Further Details:      
 
Domain Number 2 Region: 497-629
Classification Level Classification E-value
Superfamily Ricin B-like lectins 9.86e-31
Family Ricin B-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025207   Gene: ENSMMUG00000019177   Transcript: ENSMMUT00000026944
Sequence length 633
Comment pep:known chromosome:MMUL_1:12:29390604:29413272:-1 gene:ENSMMUG00000019177 transcript:ENSMMUT00000026944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHLKRLVKLHIKRHYHKKFWKLGAVVFFFIIVLVLMQREVSVQYSKEESRLERNMKNKN
KMLDLMLEAVNNIKDAMPKMQIGAPVRQNIDVGERPCLQGYYTAAELKPVLDRPPQDSNA
PGASGKAFKTTNLSVEEQKEKERGEAKHCFNAFASDRISLHRDLGPDTRPPECIEQKFKR
CPPLPTTSVIIVFHNEAWSTLLRTVHSVLYSSPAILLKEIILVDDASVDEYLHDKLDEYV
KQFSIVKIVRQRERKGLITARLLGATVATAETLTFLDAHCECFYGWLEPLLARIAENYTA
VVSPDIASIDLNTFEFNKPSPYGSNHNRGNFDWSLSFGWESLPDHEKQRRKDETYPIKTP
TFAGGLFSISKEYFEYIGSYDEEMEIWGGENIEMSFRVWQCGGQLEIMPCSVVGHVFRSK
SPHSFPKGTQVIARNQVRLAEVWMDEYKEIFYRRNTDAAKIVKQKAFGDLSKRFEIKHRL
QCKNFTWYLNNIYPEVYVPDLNPVISGYIKSVGQPLCLDVGENNQGGKPLIMYTCHGLGG
NQYFEYSAQHEIRHNIQKELCLHAAQGLVQLKACTYKGHKTVVTGEQIWEIQKDQLLYNP
FLKMCLSANGEHPSLVSCNPSDPLQKWIFSQND
Download sequence
Identical sequences F6R689 G7PKQ2
ENSMMUP00000025207 ENSMMUP00000025207 9544.ENSMMUP00000025207 XP_001096023.1.72884 XP_005573417.1.63531 XP_005573418.1.63531 XP_005573419.1.63531 XP_014965763.1.72884 XP_014965764.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]