SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025211 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025211
Domain Number 1 Region: 5-134
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.2e-29
Family Galectin (animal S-lectin) 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025211   Gene: ENSMMUG00000019181   Transcript: ENSMMUT00000026948
Sequence length 144
Comment pep:known chromosome:MMUL_1:3:40478633:40479876:-1 gene:ENSMMUG00000019181 transcript:ENSMMUT00000026948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSTQFEAFCAGGLAPGWNLLIQGHADSGEDRFEIHFLSETGDIAFHVKPRFSSTTMVGSA
FQGGRWGLAELSSIFPLAPGEPFEIEVSSDVEHFHVYSWEHKVLQSPHRQRPLGTITRVC
VLSDHLWSRVKLVTSQLRMKLNGY
Download sequence
Identical sequences ENSMMUP00000035536 ENSMMUP00000025211 9544.ENSMMUP00000035536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]