SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025212 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025212
Domain Number 1 Region: 202-381
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.98e-35
Family APC10-like 0.0021
Further Details:      
 
Domain Number 2 Region: 1819-1879
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000565
Family ZZ domain 0.0082
Further Details:      
 
Domain Number 3 Region: 1777-1828
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000695
Family ZZ domain 0.02
Further Details:      
 
Domain Number 4 Region: 93-159
Classification Level Classification E-value
Superfamily EF-hand 0.00000187
Family Polcalcin 0.061
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000025212
Domain Number - Region: 1119-1192
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00406
Family Spermadhesin, CUB domain 0.0085
Further Details:      
 
Domain Number - Region: 2706-2795
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0196
Family Spermadhesin, CUB domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025212   Gene: ENSMMUG00000019180   Transcript: ENSMMUT00000026949
Sequence length 2961
Comment pep:known chromosome:MMUL_1:16:3729006:3870096:-1 gene:ENSMMUG00000019180 transcript:ENSMMUT00000026949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNAPSHSSEDEAAAAGGEGWGPHQDWAAVSGTTPGPGLAAPALPPAAALLEPARLREAA
AALLPTPPCESLVSRHRGALFRWLEERLGRGEESVTLEQFRELLEARGAGCSSEQFEEAF
AQFDAEGDGTVDAENMLEALKNSSGANLQGELSHIIRQLQACSLVPGFIDIFSESKEGLD
AHSSMILRFLHRNRLSSAVMPYPMLEHCKNMCTMRSSVLKESLDQLVQKEKESPGDLTRS
PEMDKLKSVAKCYAYIETSSNSADIDKMTNGETSSYWQSDGSACSHWIRLKMKPDVVLRH
LSIAVAATDQSYMPQQVTVAVGRNASDLQEVRDVHIPSNVTGYVTLLENANVSQLYVQIN
IKRCLSDGCDTRIHGLRAVGFQRVKKSGVSVSDASAIWYWSLLTSLVTASMETNPAFVQT
VLHNTQKALRHMPPLSLSPGSTDFSTFLSPNVLEEVDSFLIRITSCCSTPEVELTLLAFA
LARGSVAKVMSSLCTITDHLDTQYDASSLILSMASVRQNLLLKYGKPLQLTLQACDVKGK
EDKSGPENLLVEPWTRDGFLTETGKTRASTIFSTGTESSFQVTQIRIMVRRGGIGAQCGL
VFAYNSSSDKFCAEEHFKRFEKYDKWKLQELRQFVKSRIGCSSDDLGEDDPIGWFELEEE
WDEADVKLQQCRVAKYLMVKFLCTRQESAERLGVQGLSISGYLRPARAEAEQSVTCAHCR
KDTEESVCGATLLLRTLQFTQQLAHDLVQQKESGLKYKSFLDFTGLDLQIFWNFYSKLKQ
NPREECISAQTLLLQLLQSCFSVLQGDVLAASEEEKPPIQSPKGVEAAKELYTHLCDVVD
RVDGDSVPMEILKQEVRNTLLNGAAIFFPNRQTRRNHLFTMMNVTEQEHKQSLQLTFRSL
CTYFSDKDPGGLLLLPEKNDLAKMNISEVLAVMDTLLSVAARECELLMLSGAPGEVGSVL
FSLFWSVQGSLLSWCYLQLKSTDSGAKDLAVDLIEKYVGQFLASMRVILESLLSQYSGKT
IVERLCNSVFSMAARQLVIFLLDFCTLDIPHCVLLREFSVLTELLKKLCSGPEGGLRKLD
VETWQQEQPVVLHTWTKESAHNYENNCHEASVFVSPGATYFEVEFDDRCETEKRYDYLEF
TDARGRKTRYDTKVGTDKWPKKVTFKAGPRLQFLFHSDSSHNEWGYKFTVTAYGLPDVAV
SWGLDLQLLVSRLMGRLASQCMALKSVHQLGSNMAIPQAKMALVLSSPLWKPVFRHQICP
ELELEASWPTHPHQNSKEVKNIPDDPCRHFLLDFAQSEPAQNFCGPYSELFKGFIQACRK
QAPKTDIVAGSTIDQAVNATFAALVYRTPDLYEKLQKYVNSGGKIALSDEFAQVYSLADG
IRIWMLEMKQKSLMSLGNEAEEKHRSEATEANPESLAKDCIEKSLLLLKFLPTGIRSKES
CDKLETADETNHLQPLEKRQRTSSVVEEHFQASVSPTEAATPATGDRSPGLDTQPKLPSS
SGLPAADVSPATAEEPLSPSTPTRRPPFTRGRLRLLSFRSMEEARLVPTVKEKYPVLKDV
MDFIKDQSLSHRSVVKVLSLRKAQAQSILDVLRITQYCAESLGQPHCFHPPFILFLLELL
TCQKDFTNYFGHLEGCGADLHKEIRDAYYQLVLFLVKAVKGFSSLNDRSLLPALSCVQTA
LLHLLDMGWEPSDLAFFVDIQLPDLLMKMSQENISVHDSVISQWSEEDELADAKQNSEWM
DECQDGMFEAWYEKIAQEDPEKQRKMHMFIARYCDLLNVDISCDGCDEIAPWHRYRCLQC
SDMDLCKTCFLGGVKPEGHGDDHEMVNMEFTCDHCQGLIIGRRMNCNVCDDFDLCYGCYA
AKKYSYGHLPTHSITAHPMVTIRISDRQRLIQPYIHNYSWLLFAALALYSAHLTSAEDVD
GEKLDPQTRSSATTLRSQCMQLVGDCLMKAHQGKGLKALALLGILPDGDSIPEDQALPAT
APTQASEEQLEKKTVQGAELSEAGNGKRAVHEEVRPADFKQRSKADKGVLLTKDPSCQTQ
ISDSPADASTPIGLPDAEDSEASSQKPREEKAVTPSPEQVFAECSQKRILGLLAAMLPPL
KSGPTVPLVDLEHVLPLMFQVVISNAGHLNETYHLTLGLLGQLIIRLLPAEVDAAVIKVL
SAKHNLFAAGDSTIVPDGWKTTHLLFSLGAVCLDSRVGLDWACSMAEILRSLNSAPLWRD
VIATFTDHCIKQLPFQLKHTNIFTLLVLVGFPQVLCVGTRCVYMDNANEPHNVIILKHFT
EKNRAVIVDVKTRKRKTVKDYQLVQKGGGQECGDSQAQLSQYSQHFAFIASHLLQTSMDS
HCPEAVEATWVLSLALKGLYKTLKAHGFEETHATFLQTDLLKLLVKKCSKGTGFSKTWLL
RDLEILSIMLYSSKKEMNALAEHGDLELDERGDREEEVERPISSPGDPEQKKLDPLEGLD
EPTRICFLMAHDALNAPLHILRAIYELQMKKTDSFFLEVQKRFDGDELTTDERIRSLAQR
WQPSKSLRLEEQSAKAVDTDMIILPCLSRPARCDQATAESNPVTQKLISSTESELQQSYA
KQRRSKSAALLHKELNCKSKRAVRDYLFRVNEATAVLYARHVLASLLAEWPSHVPVSEDI
LELSGPAHMTYILDMFMQLEEKHEWEKILQKVLQGCREDMLGTMALAACQFMEEPGMEVQ
VRESKHPYNNNTNFEDKVHIPGAIYLSIKFDSQCNTEEGCDELAMSSSSDFQQDRHSFSG
SQQKWKDFELPGDTLYYRFTSDMSNTEWGYRFTVTAGHLGRFQTGFEILKQMLSEERVVP
HLPLAKIWEWLVGVACRQTGHQRLKAIHLLLRIVRCCGHSDLCDLALLKPLWQLFTHMEY
SLFEDVTQPGILLPLHRALTELFFVTENRAQELGVLQDYLLALTTDDHLLRCAAQALQNI
AAISLAINYPNKATRLWNVEC
Download sequence
Identical sequences 9544.ENSMMUP00000025212 ENSMMUP00000025212 ENSMMUP00000025212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]