SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025214 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025214
Domain Number 1 Region: 35-134
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 1.7e-26
Family Steroid-binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025214   Gene: ENSMMUG00000019183   Transcript: ENSMMUT00000026951
Sequence length 264
Comment pep:known chromosome:MMUL_1:16:3870817:3885050:1 gene:ENSMMUG00000019183 transcript:ENSMMUT00000026951 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRLGGRGLLLGLAVAAAAVMAARLMGWWGPRAGFRLFIPEELSRYRGGPGDPGLYLALL
GRVYDVSSGRRHYEPGSHYSGFAGRDASRAFVTGDYSEAGLVDDISDLSSSEMLTLQHWL
SFYEKNYVCVGRVIGRFYGEDGLPTPALTQVEATITRGLEANKLELQEKQTFPPCNAEWS
SARGSRLWCSQKSGGVSRDWIGVPRKLYKPGAKEPRCVCVRTTGPPSDQMPDNPPHRNRG
DLDHPNLAEYTGCPPLAITCSFPL
Download sequence
Identical sequences A0A2K5VVH0 A0A2K6DAQ4 F6QZ82
9544.ENSMMUP00000025214 ENSMMUP00000025214 ENSMMUP00000025214 NP_001180897.1.72884 XP_005582607.1.63531 XP_011723358.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]