SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025241 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025241
Domain Number 1 Region: 229-495
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.46e-71
Family Protein kinases, catalytic subunit 0.00000000911
Further Details:      
 
Domain Number 2 Region: 119-261
Classification Level Classification E-value
Superfamily SH2 domain 1.27e-37
Family SH2 domain 0.00000238
Further Details:      
 
Domain Number 3 Region: 60-143
Classification Level Classification E-value
Superfamily SH3-domain 1.74e-20
Family SH3-domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025241   Gene: ENSMMUG00000019206   Transcript: ENSMMUT00000026980
Sequence length 505
Comment pep:known chromosome:MMUL_1:8:9181022:9205246:-1 gene:ENSMMUG00000019206 transcript:ENSMMUT00000026980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLVSSKKPDKEKPIKEKDKGQWSPLKVSAQDKDPPPLPPLVVFNHLTPPPPKEHLEEDE
HFVVALYDYAAMNDRDLQMLKGEKLQVLKGTGDWWLAKSLVTGREGYVPSNFVARVESLE
VERWFFRSLSRKEAERQLLAPINKTGSFLIRESETNKGAFSLSVKDVTTQGELIKHYKIR
SLDEGGYYISPRITFPSLQALVQHYSKKGDGLCQRLTLPCVSLAPQNPWAQDEWEIPRQS
LRLVRKLGSGQFGEVWMGYYKNNMKVAIKTLKEGTMSPEAFLGEANVMKALQHERLVRLY
AVVTKEPIYIVTEYMARGGREGQARREGGTGWAWSFTMCLFPQIAEGMAYIERMNSIHRD
LRAANILVSEALCCKIADFGLARIIDSEYTAQEGAKFPIKWTAPEAIHFGVFTIKADVWS
FGVLLMEVVTYGRVPYPGMSNPEVIRNLERGYRMPRPETCPPELYRGVIAECWRSRPEER
PTFEFLQSVLEDFYTATERQYELQP
Download sequence
Identical sequences 9544.ENSMMUP00000025241 ENSMMUP00000025241 ENSMMUP00000025241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]