SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025296 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025296
Domain Number 1 Region: 250-547
Classification Level Classification E-value
Superfamily Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 1.44e-113
Family Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.000000000425
Further Details:      
 
Domain Number 2 Region: 7-247
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.47e-60
Family G proteins 0.0000000028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025296   Gene: ENSMMUG00000019251   Transcript: ENSMMUT00000027039
Sequence length 563
Comment pep:known chromosome:MMUL_1:1:91755255:91816201:-1 gene:ENSMMUG00000019251 transcript:ENSMMUT00000027039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPEIHMTGPMCLIENTNGELVANPEALKILSAITQPVVVVAIVGLYRTGKSYLMNKLAG
KNIGFSLGSTVESHTKGIWMWCVPHPKKPEHTLVLLDTEGLGDVKKGDNQNDSWIFALAI
LLSSTFVYNSMGTINQQAMDQLHYVTELTHRIRSKSSPDENENEDSADFVSFFPDFVWTL
RDFSLDLEADGQPLTADEYLEYSLKLTQGNRDLAQLEKLHDEELDPEFVQQVADFCSYIF
SNSKTKTLSGGIKVNGPRLESLVLTYIDAISSGDLPCMENAILALAQIENSVAVQKAIAH
YDQQMGQKVQLPTETLQELLDMHRVSEREATEVFMKNSFKDVDHLFQKKLAVQLVKKRDD
FCKQNQEASSDHCSALLQDIFSPLEEEVKLGIYSKPGGYRLFIQKLQDLKKKYHEEPRKG
IQAEEILQTYLKSKESVTDAILQTDKILTKKEKEIEVEHAKAESAQASAKMVEEMQIKYQ
QMMEEKEKSYQEHVKQLTEKIERERAQLLEEQERTLTSKLQEQARLLKERCQGESTQLQN
EIQKLQKTLEKKTKRFMSHKLKI
Download sequence
Identical sequences ENSMMUP00000025296 ENSMMUP00000025296 9544.ENSMMUP00000025296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]