SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025300 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025300
Domain Number 1 Region: 55-88,138-189,248-412
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.17e-32
Family Lipase 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025300   Gene: ENSMMUG00000019254   Transcript: ENSMMUT00000027043
Sequence length 439
Comment pep:known chromosome:MMUL_1:4:46529320:46562332:-1 gene:ENSMMUG00000019254 transcript:ENSMMUT00000027043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPPKLCVLFCLCGCLAVVHPFDWQYLNPVAHMKSSAWVNKIQVLMAAASFGEAKIPKGN
GPYSVGCTDLMFDHTKKGTFLRLYYPSQDDDRLDTLWIPNKEYFWGLSKYLGKHWLMGNI
LSLLFGSVTTPANWNSPLRPGEKYPLVVFSHGLGAFRTIYSAIGIDLASHGFIVAAVEHR
DRSASATYYFKNQSAAEIGKKSWLYLRTLKEEEEIHIRNKQVRQRAKECSQALNLILDID
HGKPVKNALDLKFDMEQLKDSIDREKIAVIGHSFGGATVIQTLSEDQRFRCGIALDAWML
PLGDEVYSRIPQPLFFINSEYFQYPANIIKMKKCYSPDKERKMITIRGSVHQNFADFTFA
TGKIIGRMLKLKGDIDSDVAIDLSNKASLAFLQKHLGLHKDFDQWDCLIEGDDENLIPGT
NINTTNQHIMLQSSSGTEN
Download sequence
Identical sequences A0A2K5TSM5 F6SQA6
9544.ENSMMUP00000025300 XP_005552858.1.63531 XP_005552859.1.63531 XP_005552860.1.63531 XP_014991983.1.72884 XP_014991984.1.72884 ENSMMUP00000025300 ENSMMUP00000025300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]