SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025333 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025333
Domain Number 1 Region: 183-389
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.02e-62
Family Nuclear receptor ligand-binding domain 0.000017
Further Details:      
 
Domain Number 2 Region: 43-114
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.32e-25
Family Nuclear receptor 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025333   Gene: ENSMMUG00000019276   Transcript: ENSMMUT00000027077
Sequence length 390
Comment pep:known chromosome:MMUL_1:7:50456890:50462985:1 gene:ENSMMUG00000019276 transcript:ENSMMUT00000027077 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NTRPTALMSSTVAAAAPAAGAASRKESPGRWGLGEDPTGVSPSLQCRVCGDSSSGKHYGI
YACNGCSGFFKRSVRRRLIYRCQVGAGMCPVDKAHRNQCQACRLKKCLQAGMNQMESSNE
PRPEPLVATPTPAGPSPRGPTPMSAARALGHHFMASLITAETCAKLEPEDADENIDVTSN
DPEFPSSPYSSSSPCGLDSIHETSARLLFMAVKWAKNLPVFSSLPFRDQVILLEEAWSEL
FLLGAIQWSLPLDSCPLLAPPEASTAGGAQGRLTLASMETRVLRETISRFRALAVDPTEF
ACMKALVLFKPETRGLKDPEHVEALQDQSQVMLSQHSKAHHPSQPVRFGKLLLLLPSLRF
ITAERIELLFFRKTIGNTPMEKLLCDMFKN
Download sequence
Identical sequences ENSMMUP00000025333 9544.ENSMMUP00000025333 ENSMMUP00000025333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]