SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025402 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025402
Domain Number 1 Region: 1781-1902
Classification Level Classification E-value
Superfamily Bromodomain 5.63e-36
Family Bromodomain 0.0002
Further Details:      
 
Domain Number 2 Region: 530-657
Classification Level Classification E-value
Superfamily DNA-binding domain 1.05e-24
Family Methyl-CpG-binding domain, MBD 0.013
Further Details:      
 
Domain Number 3 Region: 1667-1731
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.99e-18
Family PHD domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025402   Gene: ENSMMUG00000019332   Transcript: ENSMMUT00000027153
Sequence length 1908
Comment pep:known chromosome:MMUL_1:11:53682223:53702515:-1 gene:ENSMMUG00000019332 transcript:ENSMMUT00000027153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EMEANDHFNFTGLPPAPAASGLKPSPSSGEGLYTNGSPMNFPQQGKSLNGDVNVNGLSTV
SHTTTSGILNSAPHSSSTSHLHHPSVAYDCLWNYSQYPSANSGSNLKDPPLLSQFSGGQY
PLNGILGGSRQPSSPSHNTNLRAGSQEFWANGTQSPMGLNFDSQELYDSFPDQNFEVMPN
GPPSFFTSPQTSPMLGSSIQTFAPSQEVGSDIHPDEAAEKEMTSVVAENGTGLVGSLELE
EEQPELKMCGYNGSVPSVESLHQEVSVLVPDPTVSCLDDPSHLPDQLEDTPILSEDSLEP
FNSLAPEPVSGGLYGIDDTELMGAEDKLPLEDSPVISALDCPSLNNATAFSLLADDSQTS
ASIFASPTSPPVLGESVLQDNSFDLNNGSDAEQEEMETQSSDFPPSLTQPAPDQSSTIQL
HPATSPAVSPTTSPAVSLVVSPAASPEISPEVCPAASTVVSPAVFSVVSPASSAVLPAVS
SEVPLTASVTSPKASPVTSPAAAFPTASPANKDASSFLETTADLEEITGEELTTSSSGDV
MRRRIATPEEVRLPLQHGWRREVRIKKGSHRWQGETWYYGPCGKRMKQFPEVIKYLSRNV
VHSVRREHFSFSPRMPVGDFFEERDTPEGLQWVQLSAEEIPSRIQAITGKRGRPRNTEKT
KTKEVPKVKRGRGRPPKVKITELLDKTDNRLLKKLEAQETSNEEDKAKIGKSKKKMRQKV
QRGECQTTIQGQARNKRKQETKSLKQKEAKKKSKAEKEKGKTKQEKLKEKVKREKKEKVK
MKEKEEVAKAKPACKADKTLATQRRLEERQRQQMILEEMKKPTEDMCLTDHQPLPDFSRV
PGLTLPSGAFSDCLTIVEFLHSFGKVLGFDPAKDVPSLGVLQEGLLCQGDSLGEVQDLLV
RLLKAALHDPGLPSYCQSLKILGEKVSEIPLTRDNVSEILRCFLMAYGVEPALCDRLRTQ
PFQAQSPQQKAAVLAFLVHELNGSTLIINEIDKTLESMSSYRKNKWIVEGRLRRLKTVLA
KRTGRSEVEMEGPEECLGRRRSSRIMEETSGMEEEEEEESTAAVHGRRGRRDGEVDATAS
SIPELERQIEKLSKRQLFFRKKLLHSSQMLRAVSLGQDRYRRRYWVLPYLAGIFVEGTEG
NLVPEDVIKKETDSLKVAAHTSLNPALFSMKMELAGSNTTASSPARARGRPRKTKPGSMQ
PRHLKSPVRGQDSEQPQAQLQPEAQLHAPAQPQPQLQLQLQSHPQSHKGFLEQEGSPLSL
GQSQHDLSQSAFLSWLSQTQSHSSLLSSSVLTPDSSPGKLDPAPSQPPEEPEPDEAESSP
DPQALWFNISAQMPCNAAPTPPPAVSEDQPTPSPQQLASSKPMNRPSAANPCSPVQFSST
PLAGLAPKRRAGDPGEMPQSPTGLGQPKRRGRPPSKFFKQMEQRYLTQLTAQPVPPEMCS
GWWWIRDPETLDAMLKALHPRGIREKALHKHLNKHRDFLQEVCLRPSADPIFEPRQLPVF
QEGIMSWSPKEKTYETDLAVLQWVEDLEQRVIMSDLQIRGWTCPSPDSTREDLAYCEHLS
SSQEDITWRGRGREGLAPQRKTTNPLDLAVMRLAALEQNVERRYLREPLWPTHEVVLEKA
LLSTPNGAPEGTTTEISYEITPRIRVWRQTLERCRSAAQVCLCLGQLERSIAWEKSVNKV
TCLVCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCTVCLAQQVEGEFTQKPG
FPKRGQKRKSAYSLNFSEGDGRRRRVLLRGRESPAAGPQYSEEGQSPSKRRRLSMRNHHS
DLTFCEIILMEMESHDAAWPFLEPVNPRLVSGYRRIIKNPMDFSTMRERLLRGGYTSSEE
FAADALLVFDNCQTFNEDDSEVGKAGHIMRRFFESRWEEFYQGKQANL
Download sequence
Identical sequences G7N7D6 G7PII5
ENSMMUP00000025402 ENSMMUP00000025403 9544.ENSMMUP00000025403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]