SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025422 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025422
Domain Number 1 Region: 3-228
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.32e-79
Family Calponin-homology domain, CH-domain 0.00000068
Further Details:      
 
Domain Number 2 Region: 3204-3300
Classification Level Classification E-value
Superfamily EF-hand 5.9e-40
Family EF-hand modules in multidomain proteins 0.00000406
Further Details:      
 
Domain Number 3 Region: 3079-3202
Classification Level Classification E-value
Superfamily EF-hand 1.32e-39
Family EF-hand modules in multidomain proteins 0.00000209
Further Details:      
 
Domain Number 4 Region: 2045-2202
Classification Level Classification E-value
Superfamily Spectrin repeat 2.23e-23
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 5 Region: 988-1144
Classification Level Classification E-value
Superfamily Spectrin repeat 2.4e-22
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 6 Region: 2153-2310
Classification Level Classification E-value
Superfamily Spectrin repeat 5.33e-22
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 7 Region: 3280-3368
Classification Level Classification E-value
Superfamily RING/U-box 3.06e-21
Family ZZ domain 0.0092
Further Details:      
 
Domain Number 8 Region: 2519-2680
Classification Level Classification E-value
Superfamily Spectrin repeat 9.85e-19
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 9 Region: 1095-1255
Classification Level Classification E-value
Superfamily Spectrin repeat 3.02e-18
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 10 Region: 328-438
Classification Level Classification E-value
Superfamily Spectrin repeat 3.8e-18
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 11 Region: 1205-1359
Classification Level Classification E-value
Superfamily Spectrin repeat 2.49e-17
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 12 Region: 2746-2872
Classification Level Classification E-value
Superfamily Spectrin repeat 4.73e-17
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 13 Region: 2895-3033
Classification Level Classification E-value
Superfamily Spectrin repeat 8.38e-17
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 14 Region: 514-652
Classification Level Classification E-value
Superfamily Spectrin repeat 2.26e-16
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 15 Region: 1622-1766
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000432
Family Spectrin repeat 0.0087
Further Details:      
 
Domain Number 16 Region: 1513-1634
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000754
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 17 Region: 1817-1961
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000022
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 18 Region: 447-548
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000612
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 19 Region: 3041-3078
Classification Level Classification E-value
Superfamily WW domain 0.0000000000341
Family WW domain 0.00012
Further Details:      
 
Domain Number 20 Region: 768-891
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000535
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 21 Region: 2278-2415
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000873
Family Spectrin repeat 0.0075
Further Details:      
 
Domain Number 22 Region: 2465-2533
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000023
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 23 Region: 1422-1549
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000767
Family Spectrin repeat 0.0072
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000025422
Domain Number - Region: 908-1003
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000683
Family Spectrin repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025422   Gene: ENSMMUG00000019345   Transcript: ENSMMUT00000027175
Sequence length 3679
Comment pep:known chromosome:MMUL_1:X:28997294:29655328:-1 gene:ENSMMUG00000019345 transcript:ENSMMUT00000027175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILDEREDVQKKTFTKWVNAQFSKFGKQHIENLFSDLQDGRRLLDLLEGLTGQKLPKEKGS
TRVHALNNVNKALRVLQNNNVDLVNIGSTDIVDGNHKLTLGLIWNIILHWQVKNVMKNIM
AGLQQTNSEKILLSWVRQSTRNYPQVNVINFTTSWSDGLALNALIHSHRPDLFDWNSVVC
QQSATQRLEHAFNIARYQLGIEKLLDPEDVATTYPDKKSILMYITSLFQVLPQQVSIEAI
QEVEMLPRPPKVTKEEHFQLHHQMHYSQQITVSLAQGYERTSSPKPRFKSYAYTQAAYVT
TSDPTRSPFPSQHLEAPEDKSFGSSLMESEVNLDRYQTALEEVLSWLLSAEDTLQAQGEI
SNDVEVVKEQFHTHEGYMMDLTAHQGRVGNILQLGSQLIGTGKLSEDEETEVQEQMNLLN
SRWECLRVASMEKQSNLHRVLMDLQNQKLKELNDWLTKTEERTRKMEKEPLGPDLEDLKR
QVQQHKVLQEDLEQEQVRVNSLTHMVVVVDESSGDHATAALEEQLKVLGDRWANICRWTE
DRWVLLQDILLKWQRLTEEQCLFSAWLSEKEDVVNRIHTTGFKDQNEMLSSLQKLAVLKA
DLEKKKQSMDKLYSLKQDLLSTLKNKSVTQKMEAWLENFARCWDNLVQKLEKSTAQISQA
VTTTQPSLTQTTVMETVTMVTTREQILVKHAQEELPPPPPQKKRQITVDSEIRKRLDVDI
TELHSWITRSEAVLQSPEFAIYRKEGNFSDLKEKVNAIEREKAEKFRKLQDASRSAQVLV
EQMVNEGVNADSIRQASEQLNSRWIEFCQLLSERLNWLEYQNNIITFYNQLQQLEQMTTT
AENWLKIQPTTPSEPTAIKSQLKICKDEVNRLSALQPQIERLKIQSITLKEKGQGPMFLD
ADFVAFTNHFSQVFSDMQAREKELQTIFDTLPPMRYQETMSAIRTWVQQSETKLSIPQLS
VTDYEIMEQRLGELQVLQSSLQEQQSGLNYLSTTVKEMSKKAPSEISRKYQLEFEEIETR
WKKLSSQLAEHCQKLEEQMNKLRKIQNHIQTLKKWMAEVDVFLKEEWPALGDSEILKKQL
KQCRLLVNDIQTIQPSLNSVNEGGQKIKNEAEPEFALRLEIELKELNTQWDHMCQQVYAR
KEALKGGLEKTVSLQKDLSEMHEWMTQAEEEYLERDFEYKTPDELQKAVEEMKRAKEEAQ
QKEAKVKLLTESVNSVIAQAPPVAQEALKKELETLTTNYQWLCTRLNGKCKTLEEVWACW
HELLSYLEKANKWLNEVEFKLKTTENIPGGAEEISEVLHSLENLMQHSEDNPNQIRILAQ
TLTDGGVMDELINEELETFNSRWRELHEEAVRRQKLLEQSIQSAQEIEKSLHLIQESLTF
IDKQLTAYIADKVDAAQMPQEAQASKIQSDLTSHEISLEEMKKHNQGKEAAQRVLSQIDV
AQKKLQDVSMKFRLFQKPANFEQRLQESKMILDEVKMHLPALETKSVEQEVVQSQLNHCV
NLYKSLSEVKSEVEMVIKTGRQIVQKKQTENPKELDERVTALKLHYNELGAKVTERKQQL
EKCLKLSRKMRKEMNVLTEWLAATDMELTKRSAVEGMPSNLDSEVAWGKATQKEIEKQKV
HLKSITEVGEALKTVLGKKETLVEDKLSLLNSNWIAVTSRAEEWLNLLLEYQKHMETFDQ
NVDHITKWIIQADTLLDESEKKKSQQKEDVLKRLKAELNDIRPKVDSTRDQAANLMANRG
DHCRKLVEPQISELNHRFAAISHRIKTGKASIPLKELEQFNSDIQKLLEPLEAEIQQGVN
LKEEDFNKDMNEDNEGTVKELLQRGDNLQQRITDERKREEIKIKQQLLQTKHNALKDLRS
QRRKKALEISHQWYQYKRQADDLLKCLDDIEKKLASLPEPRDERKIKEIDRELQKKKEEL
NAVRRQAEGLSEDGAAMAVEPTQIQLSKRWREIESKFAQFRRLNFAQIHTVREETMMVMT
EDMPLEISYVPSTYLTEITHVSQALSEVEQLLNAPDLCAKDFEDLFKQEESLKNIKDILQ
QSSGRIDIIHSKKTAALQSATPVERVKLQEALSQIDFQWEKVNKMYKDRQGRFDRSVEKW
RRFHYDIKIFNQWLTEAEQFLRKTQIPENWEHAKYKWYLKELQDGIGQRQTVVRTLNATG
EEIIQQSSKTDASILQEKLGSLNLRWQEVCKQLSERKKRLEEQKNILSEFQRDLNEFVLW
LEEADNIASIPLEPGNEQQLKEKLEQVKLLVEELPLRQGILKQLNETGGPVLVSAPISPE
EQDKLENKLKRTNLQWIKVSRALPEKQGEIEAQIKDLGQLEKKLEDLEEQLNHLLLWLSP
IRNQLEIYNQPNQEGPFDIKETEIAVQAKQPDVEGILSKGQHFYKEKPATQPVKRKLEDL
SSEWKTVNHLLQELRAKQPDLAPGLTTVGASPSQTVTLVTQPVVTKETAISKLEMPSSLM
LEVPALADFNRAWTELTEWLSLLGRVIKSQRVMVGDLEDINEMIIKQKATVQDLEQRRPQ
LEELITAAQNLKNKTSNQEARTIITDRIERIQNQWDEVQEHLQNRRQQLNEMLKDSTQWL
EAKEEAEQVLGQARAKLESWKEGPYTIDAIQKKITETKQLAKDLRQWQINVDVANDLALK
LLRDYSADDTRKVHMITENINASWGSIHKREREREREVEELQNALSEFFLSFSSYLLKFT
KVEMKEKILRAAREKGRLLENRKGLKSLMIEWQDLQGEIEAHTDVYHNLDENSQKVLRSL
EGSDDAVLLQRRLDNMNFKWSELRKKSLNIRSHLEASSDQWKRLHLSLQELLVWLQLKDD
ELSRQTPIGGDFPAVQKQNDVHRAFKRELKTKEPVIMSTLETVRIFLTEQPLEGLEKLYQ
EPRELPPEERAQNVTRLLRKQAEEVNTEWEKLNLHSTDWQRKIDETLERLQELQEATDEL
DLKLRQAEVIKGSWQPVGDLLIDSLQDHLEKVKALRGEIAPLKENVSHVNDLARQLTTLG
IQLSPYNLSTLEDLNTRWKLLQVAVEDRVRQLHEAHRDFGPASQHFLSTSVQGPWERAIS
PNKVPYYINHETQTTCWDHPKMTELYQSLGKLLKVKFTLSQTKKKKRKKEKSIFVDLLSL
SAACDALDQHNLKQNDQPMDILQIINCLTTIYDRLEQEHNNLVNVPLCVDMCLNWLLNVY
DTGRTGRIRVLSFKTGIISLCKAHLEDKYRYLFKQVSSSTGFCDQRRLGLLLHDSIQIPR
QLGEVASFGGSNIEPSVRSCFQFANNKPEIEAALFLDWMRLEPQSMVWLPVLHRVAAAET
AKHQAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMHYPMVEYCTPTTSG
EDVRDFAKVLKNKFRTKRYFAKHPRMGYLPVQTVLEGDNMETPVTLINFWPVDSAPASSP
QLSHDDTHSRIEHYASRLAEMENSNGSYLNDSISPNESIDDEHLLIQHYCQSLNQDSPLS
QPRSPAQILISLESEERGELERILADLEEENRNLQAEYDRLKQQHEHKGLSPLPSPPEMM
PTSPQSPRDAELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQPQAEAKV
NGTTVSSPSTSLQRSDSSQPMLLRVVGSQTSDSMGEEDVLSPPQDTSTGLEEVMEQLNNS
FPSSRGRNTPGKPMREVSE
Download sequence
Identical sequences 9544.ENSMMUP00000025426 ENSMMUP00000025422 ENSMMUP00000025426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]