SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025457 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025457
Domain Number 1 Region: 116-417
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 7.61e-114
Family Pancreatic carboxypeptidases 0.00000000111
Further Details:      
 
Domain Number 2 Region: 19-109
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 4.68e-25
Family Pancreatic carboxypeptidase, activation domain 0.00000604
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025457   Gene: ENSMMUG00000019377   Transcript: ENSMMUT00000027213
Sequence length 421
Comment pep:known chromosome:MMUL_1:3:167675123:167747900:1 gene:ENSMMUG00000019377 transcript:ENSMMUT00000027213 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRWTLFIGALIGSSICDREKFFGDQVFRINVRNGDEISKLSQLVNSNNLKLDVWKSLSTF
NRPVDVLVPSVSLQAVKSFLRSQGLEYAVAIEDLQALLDNEDEEMQQNEGQERRSNNFNY
GAYHSLKAIYHEMDNIAADFPDLVRRVKIGHSFENRPMYVLKFSTGEGARRPAIWLNAGI
HSREWISQATAIWTARKIVSDYQRDPAITSILEKMDIFLLPVANPDGYVYTQTQNRLWRK
TRSLNPGSSCVGADPNRNWNASFAGKGASDNPCSEVYHGPHANSEVEVKSVVDFIQKHGN
FKCFIDLHSYSQLLMYPYGYSAKKAPDAKELDKVARRAAKALASVSGTEYQVGPTCTTVY
PASGSSIDWAYDNGIKFAFTFELRDTGTYGFLLPANQIIPTAEETWLGLNTIMEHVRDNL
Y
Download sequence
Identical sequences 9544.ENSMMUP00000025457 ENSMMUP00000025457 ENSMMUP00000025457 XP_001095233.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]