SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025466 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025466
Domain Number 1 Region: 426-696
Classification Level Classification E-value
Superfamily Kelch motif 1.7e-80
Family Kelch motif 0.0000019
Further Details:      
 
Domain Number 2 Region: 160-263
Classification Level Classification E-value
Superfamily POZ domain 9.94e-26
Family BTB/POZ domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025466   Gene: ENSMMUG00000019383   Transcript: ENSMMUT00000027222
Sequence length 716
Comment pep:known chromosome:MMUL_1:X:86246643:86404814:1 gene:ENSMMUG00000019383 transcript:ENSMMUT00000027222 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVSGKKEFDVKQILRLRWRWFSHPFQGSTNTGSCLQQEGYEHRGTPVQGRLKSHSRDRN
GLKKSNSPVHHNILAPVPGPAPAHQRAVQNLQQHNLIVHFQANEDTPKAVPEKNLFQEAC
GKRAQDLEMMADDNIEDSTARLDTQHSEEMNATGSEEQFHVINHAEQTLRKMENYLKEKQ
LCDVLLIAGHLRIPAHRLVLSAVSDYFAAMFTNDVLEAKQEEVRMEGVDPNALNSLVQYA
YTGILQLKEDTIESLLAAACSLLSMSWVAGAPIFYKWIHLCLLHFLKFKNMKCFDMLIPL
RNFKEHFIEVIKNQEFLLLPANEISKLLCSDDINVPDEETIFHALMQWVGHDVQNRQGEL
GMLLSYIRLPLLPPQLLADLETSSMFTGDLECQKLLMEAMKYHLLPERRSMMQSPRTKPR
KSTVGALYAVGGMDAMKGTTTIEKYDLRTNSWLHIGTMNGRRLQFGVAVIDNKLYVVGGR
DGLKTLNTVECFNPVGRIWTVMPPMSTHRHGLGVATLEGPMYAVGGHDGWSYLNTVERWD
PEGRQWNYVASMSTPRSTVGVVALNNKLYAIGGRDGSSCLKSMEYFDPHTNKWSLCAPMS
KRRGGVGVATYNGFLYVVGGHDAPASNHCSRLSDCVERYDPKSDSWSTVAPLSVPRDAVA
VCPLGDKLYVVGGYDGHTYLNTVESYDAQRNEWKEGMQELPQNFYTTQKLKETLGH
Download sequence
Identical sequences ENSMMUP00000025466 9544.ENSMMUP00000025466 ENSMMUP00000025466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]