SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025537 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025537
Domain Number 1 Region: 1-30
Classification Level Classification E-value
Superfamily DEK C-terminal domain 0.00000000405
Family DEK C-terminal domain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025537   Gene: ENSMMUG00000019429   Transcript: ENSMMUT00000027298
Sequence length 31
Comment pep:known chromosome:MMUL_1:9:69419795:69419887:-1 gene:ENSMMUG00000019429 transcript:ENSMMUT00000027298 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQICKKVYENYPTYDLTERKDFIKTTVKEL
Download sequence
Identical sequences ENSMMUP00000025537 ENSMMUP00000025537 9544.ENSMMUP00000025537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]