SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025550 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025550
Domain Number 1 Region: 15-251
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.53e-79
Family Calponin-homology domain, CH-domain 0.000000416
Further Details:      
 
Domain Number 2 Region: 2842-2966
Classification Level Classification E-value
Superfamily EF-hand 1.84e-49
Family EF-hand modules in multidomain proteins 0.00000581
Further Details:      
 
Domain Number 3 Region: 2968-3063
Classification Level Classification E-value
Superfamily EF-hand 2.47e-38
Family EF-hand modules in multidomain proteins 0.0000149
Further Details:      
 
Domain Number 4 Region: 1923-2079
Classification Level Classification E-value
Superfamily Spectrin repeat 9.36e-27
Family Spectrin repeat 0.0026
Further Details:      
 
Domain Number 5 Region: 3043-3131
Classification Level Classification E-value
Superfamily RING/U-box 5.65e-21
Family ZZ domain 0.0092
Further Details:      
 
Domain Number 6 Region: 313-418
Classification Level Classification E-value
Superfamily Spectrin repeat 9.55e-20
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 7 Region: 2505-2636
Classification Level Classification E-value
Superfamily Spectrin repeat 1.51e-19
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 8 Region: 388-526
Classification Level Classification E-value
Superfamily Spectrin repeat 5.63e-17
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 9 Region: 494-631
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000158
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 10 Region: 2281-2439
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000196
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 11 Region: 743-901
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000864
Family Spectrin repeat 0.0062
Further Details:      
 
Domain Number 12 Region: 962-1083
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000108
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 13 Region: 1181-1333
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000122
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 14 Region: 2682-2801
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000128
Family Spectrin repeat 0.0075
Further Details:      
 
Domain Number 15 Region: 2053-2178
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000196
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 16 Region: 1492-1647
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000753
Family Spectrin repeat 0.0066
Further Details:      
 
Domain Number 17 Region: 2804-2841
Classification Level Classification E-value
Superfamily WW domain 0.0000000000905
Family WW domain 0.00023
Further Details:      
 
Domain Number 18 Region: 1602-1745
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000101
Family Spectrin repeat 0.0087
Further Details:      
 
Domain Number 19 Region: 1083-1188
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000035
Family Spectrin repeat 0.0053
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000025550
Domain Number - Region: 1306-1396
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000473
Family Spectrin repeat 0.0086
Further Details:      
 
Domain Number - Region: 1414-1509
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00227
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number - Region: 690-759
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0101
Family Spectrin repeat 0.0081
Further Details:      
 
Domain Number - Region: 2233-2299
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0374
Family Spectrin repeat 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025550   Gene: ENSMMUG00000019438   Transcript: ENSMMUT00000027314
Sequence length 3433
Comment pep:known chromosome:MMUL_1:4:118807221:119385717:-1 gene:ENSMMUG00000019438 transcript:ENSMMUT00000027314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKYGEHEASPDNGQNEFSDIIKSRSDEHNDVQKKTFTKWINARFSKSGKPPINDMFTDL
KDGRKLLDLLEGLTGTSLPKERGSTRVHALNNVNRVLQVLHQNNVELVNIGGTDIVDGNH
KLTLGLLWSIILHWQVKDVMKDVMSDLQQTNSEKILLSWVRQTTRPYSQVNVLNFTTSWT
DGLAFNAVLHRHKPDLFSWDKVVKMSPIERLEHAFSKAQTYLGIEKLLDPEDVAVQLPDK
KSIIMYLTSLFEVLPQQVTIDAIREVETLPRKYKKECEEEAINIQSTAPEEKHEIPRAET
PSTVTEVDADLDSYQIALEEVLTWLLSAEDTFQEQDDISDDVEEVKDQFATHEAFMMELT
AHQSSVGSVLQAGNQLITQGTLSDEEEFEIQEQMTLLNARWEALRVESMDRQSRLHDVLM
ELQKKQLQQLSTWLTLTEERIQKMETCPLDDDVQSLQKLLEEHKSLQSDLEAEQVKVNSL
THMVVIVDENSGESATAILEDQLQKLGERWTAVCRWTEERWNRLQEINILWQELLEEQCL
LKAWLTEKEEALNKVQTSNFKDQKELSVSVRRLAILKEDMEMKRQTLDQLSEIGQDVRQL
LDNSKASKKINSDSEELTQRWDSLVQRLEDSSNQVTQAVAKLGMSQIPQKDLLETVRVRE
QATTKKSKQELPPPPPPKKRQIHVDIEAKKKFDAVSAELLNWILKSKPAIQTTEIKEYMK
MQDTSEMKKKLKALEKEQRERIPRADELNQTGQILVEQMGKEGLPTEEIKNVLEKVLSEW
KNVSQHLKDLERKIQLQEDINAYFKQLDELEKVIKTKEEWVKHTSVSESSWQSLPSLKDS
CQRELTNLLGLHPKIEMARASCSALKSQPSAPDFVQRGFDSFLGRYQAVQQALKDRQQQL
ENELKGQPGHAYLETLKTLKFVLNDSENKAQTSLSVLDDPAKVEKALQEKKALDEILENQ
KPTLHKLAEETKALEKNVHPDVEKLYKQEFDDVQGKWNKLKVLVSKDLHLLEEITLKLRA
FEADSTVIERWMDGVKDFLMKQQAARGNNADLQRQLDQCSAFVNEIETIESSLKNMKEIE
TNLRSGPIAGIKTWVQTRLSDYQTQLEKLSKEIATQKSRLSESQEKAANLKKDLAEMQEW
MTQAEEEYLERDFEYKSPEELESAVQEMKRAKEDVLQKEVRVKILKDNIKLLAAKVPSGG
QELTSELNVVLENYQLLCNRIRGKCHTLEEVWSCWIELLHYLDLETTWLNTLEERMKSTE
VLPEKTDAVNEALESLESVLRHPADNRTQIRELGQTLIDGGILDDIISEKLEAFNSRYED
LSHLAESKQISLEKQLQVLRETDQMLQVLQESLGELDKQLTTYLTDRVDAFQVPQEAQKI
QAEISAHELTLEELRRNMRSQPPTSPESRTARGGSQMDVLQRKLREVSTKFQLFQKPANF
EQRMLDCKRVLDGVKAELHVLDVKDVDPDVIQTHLDKCMKLYKTLSEVKLEVETVIKTGR
HIVQKQQTDNPKGMDEQLTSLKVLYNDLGAQVTEGKQDLERASQLARKMKKEAASLSEWL
SATEAELVQKSTSEGLLGDLDTEISWAKNVLKDLEKRKVDLNTITESSAALQNLIEGSEP
ILEEKLCVLNAGWSRVRTWTEDWCNTLMNHQNQLEIFDGNVAHISTWLYQAEALLDEIEK
KPASKREEIVKRLVSELDDANLQVENVRDQALILMNARGSSSRELVEPKLAELNRNFEKV
SQHIKSAKLLIAQEPLSYRCLVTTETFETGVPFSDLEKLENDIENMLKVVEKHLESSDED
EKMDEERAQIEEVLQRGEEMLHQPMEDNKKEKIRLQLLLLHTRYNKIKGFPIQQKKMGQL
AFGIRSSLPTDYLVEINKILLCMDDVELSLNIPELNTAIYEDFSFQEDSLKNIKDQLDKL
GEQIAVIHEKQPDVILEASGPEAIQIRDTLTQLNAKWDRINRMYSDRKGYFDRAMEEWRQ
FHCDLNDLTQWITEAEELLVDTCAPGGSLDLEKARIHQQELEEGISSHRPSFAALNRTGD
GIVQKLSQADGSFLKDKLAGLNQRWDAIIAEVKDRQPRLKGESKQVMEYRHQLDGIICWL
TKAEHAMQKRSTAELGENLQELRDLTQEMEVHAEKLKWLNRTELEILSDKSLSLPERDKI
SESLRTVNMTWNKICREVPTTLKECIQEPSSVSQTRIAAHPSVQKVVLVSSASDIPVQSH
RTSEISIPADLDKTITELADWLVLIDQMLKSNIVTVGDVEEINKTVSRMKITKADLEQRH
PQLDYVFTLAQNLKNKASSSDVRTAITEKLERVKNQWDGTQHGVELRQQQLEDMIIDSLQ
WDDHREETEELMRKHEARLYILQQSRRDPLTKQISDNQILLQELGPGDGIVMAFDNILQK
LLEEYGNDDTRNVKETTEYLKTSWINLKQSIADRQNALEAEWRTVQASRGDLENFLKWIQ
EAETTVNVLADASHRENALQDSILARELKQQMQDIQAEIDAHNDIFKSIDGNRQKMVKAL
GNSEEATMLQHRLDDMNQRWNDLKAKSASIRAHLEASAEKWNRLLMSLEELIKWLNMKDE
ELKKQMPIGGDVPALQLQYDHCKALRRELKEKEHSVLNAVDQARVFLADQPIEAPEEPRR
NLQSKTELTPEEKAQKIAKAMRKQSSEVKEKWESLNAVTSNWQKQVDKALEKLRDLQGAM
DDLDADMKEAESVRNGWKPVGDLLIDSLQDHIEKIMAFREEIAPINLKVKTVNDLSSQLS
PLDLHPSLKMSRQLDDLNMRWKLLQVSVDDRLKQLQEAHRDFGPSSQHFLSTSVQLPWQR
SISHNKVPYYINHQTQTTCWDHPKMTELFQSLADLNNVRFSAYRTAIKIRRLQKALCLDL
LELSTTNEIFKQHKLNQNDQLLSVPDVINCLTTTYDGLEQMHKDLVNVPLCVDMCLNWLL
NVYDTGRTGKIRVQSLKIGLMSLSKGLLEEKYRYLFKEVAGPTEMCDQRQLGLLLHDAIQ
IPRQLGEVAAFGGSNIEPSVRSCFQQNNNKPEISVKEFIDWMRLEPQSMVWLPVLHRVAA
AETAKHQAKCNICKECPIVGFRYRSLKHFNYDVCQSCFFSGRTAKGHKLHYPMVEYCIPT
TSGEDVRDFTKVLKNKFRSKKYFAKHPRLGYLPVQTVLEGDNLETPITLISMWPEHYDPS
QSPQLFYEDTHSRIEQYATRLAQMERTNGSFLTDSSSTTGSVEDEHALIQQYCQTLGGES
PVSQPQSPAQILKSVEREERGELERIIADLEEEQRNLQVEYEQLKDQHLRRGFPVGSPPE
SIVSPHHTSEDSELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQPESDT
RINGVSPWASPQHSALSYSLDLDASGAQFHQAAGEDLLAPPHDTSTDLTEVMEQIHSTFP
SCCPNVPSRPQVR
Download sequence
Identical sequences ENSMMUP00000025550 ENSMMUP00000025550 9544.ENSMMUP00000025550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]