SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025612 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025612
Domain Number 1 Region: 5-152,256-296
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.44e-39
Family FAD-linked reductases, N-terminal domain 0.000000546
Further Details:      
 
Domain Number 2 Region: 132-242
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 8.5e-37
Family L-aminoacid/polyamine oxidase 0.000000803
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025612   Gene: ENSMMUG00000019489   Transcript: ENSMMUT00000027384
Sequence length 360
Comment pep:known chromosome:MMUL_1:X:41471367:41488179:1 gene:ENSMMUG00000019489 transcript:ENSMMUT00000027384 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTARRFATLFVNINVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVS
ERIMDLLGDKVKLNQPVTHVDQSSDNIIIETLNHEHYECKYVINAIPPTLTAKIHFRPEL
PAERNQLIQRLPMGAIIKCMMYYKEAFWKKKDYCGCMIIEDEDAPISITLDDTKPDGSLP
AIMGFILARKADRLAKLHKEIRKKKICELYAKVLGSQEALHPVHYEEKNWCEEQYSGGCY
TAYFPPGIMTQYGRVIRQPVGRIFFAGTETATKWSGYMEGAVEAGERAAREVLNGLGKVN
EKDIWVQEPESKDVPAVEITHTFWERNLPSVSGLLKIIGFSTSVTALGFVVYKYKLLPRS
Download sequence
Identical sequences ENSMMUP00000025612 9544.ENSMMUP00000025612 ENSMMUP00000025612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]