SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025651 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025651
Domain Number 1 Region: 856-1094
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.67e-59
Family Tandem AAA-ATPase domain 0.0000604
Further Details:      
 
Domain Number 2 Region: 633-813,957-1000
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.82e-41
Family Tandem AAA-ATPase domain 0.000035
Further Details:      
 
Domain Number 3 Region: 1216-1286
Classification Level Classification E-value
Superfamily HRDC-like 0.0000000000545
Family HRDC domain from helicases 0.014
Further Details:      
 
Domain Number 4 Region: 1072-1187
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000272
Family RecQ helicase DNA-binding domain-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025651   Gene: ENSMMUG00000019526   Transcript: ENSMMUT00000027428
Sequence length 1416
Comment pep:known chromosome:MMUL_1:7:70428291:70541086:1 gene:ENSMMUG00000019526 transcript:ENSMMUT00000027428 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVPQNNLQEQLERHSARTLNNKLSLSKPKFSGFTFKKKTSSDNNVSVTNVSVAKTPVL
RNKDVNVTEDFSLSEPPPDTTNQQRVKDFFKNAPAGQQTQRVGSTPLLPDFLQTPKEVLC
TTQNTPTVKKSQNTALKKLEFSSSPDSFRTINDWDDMDDFDTSGTSKAFVTPPQSHFVRV
STAQKSKKAKRNFFKAQLYTTNTVKADLPPSFSESEQIDLTKEQKDDSEWLSSDVICIDD
GPIGEVHINEDAQESDSLKTHLEDERDNSEKKKNLEEAELHSTEKVPCIEFDDDDYDIDF
VPPSPEEISASSSSSKCLSMLKDLDTSDRKEDVLSTSKDLLSKPEKMSTQEPNPETSTDC
DARQINLQQQLIHVMDHICKLIDTIPADKLKLLDCGNELLQQRNIRRKLLTEVDFNKSDA
SLLGSVWRCRPDSLDGPVEGDSCSAGNSMKELNFSHLPSNSVSPGDYLLTTTLGKTGFSA
TRENLFERPSFNTPLQKSFVSSNWAETPRLGKKNESSYFPGNVLTSTAVKDQNKHTASIN
DLERETQPSYDIDNFDIDDFDDDDDWENIMHNLAASKSSTAAYQPIKEGRPIKSVSERLS
SAKTNCLPVASTAQNINFSESIQNYTDKSAQNLASRNLKHERFQSLSFPHTKEMMKIFHK
KFGLHNFRTNQLEAINAALLGEDCFILMPTGGGKSLCYQLPACVSPGVTIVISPLRSLIV
DQVQKLTSLDIPATYLTGDKTDSEATNIYLQLSKKDPIIKLLYVTPEKICASNRLISTLE
NLYERKLLARFVIDEAHCVSQWGHDFRQDYKRMNMLRQKFPSVPVMALTATANPRVQKDI
LTQLKILRPQVFSMSFNRHNLKYYVLPKKPKKVAFDCLEWIRKHYPYDSGIIYCLSRREC
DTMADTLQRDGLAALAYHAGLSDSARDEVQQKWINQDGCQVICATIAFGMGIDKPDVRFV
IHASLPKSMEGYYQESGRAGRDGEISHCLLFYTYHDVTRLKRLIIMEKDGNHHTRETHFN
NLYSMVHYCENITECRRIQLLAYFGENGFNPDFCKKHPDVSCDNCCKTKDYKTRDVTDDV
KSIIRFVQEHSSSQGMRNVKHVGPSGRFTMNMLVDIFLGSKSAKIQSGIFGKGSAYSRHN
AERLFKKLILDKILDEDLYINANDQAIAYVMLGNKAQTVLNGNLKVDFMETENSSSVKKQ
KALVAKVSQREEMVKKCLGELTEVCKSLGKVFGVHYFNIFNTVTLKKLAESLSSDPEVLL
QIDGVTEDKLEKYGAEVISVLQKYSEWTSPAEDNSPGMSLSGSRGPGRSTAEELDEEISV
SSHYFTSKTRNERKRKKMPASQRPKRRKTASSGSKAKGGSATCRKISSKTKSSSIIGSSS
ASHTSQVTSGANRKLGIMAPPKPINRPFLKPSYAFS
Download sequence
Identical sequences A0A1D5R692
ENSMMUP00000025651 9544.ENSMMUP00000025651 ENSMMUP00000025651 XP_001097543.1.72884 XP_014998514.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]