SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025703 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025703
Domain Number 1 Region: 114-435
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.63e-59
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000348
Further Details:      
 
Domain Number 2 Region: 430-576
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2.59e-28
Family Ricin B-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025703   Gene: ENSMMUG00000019561   Transcript: ENSMMUT00000027480
Sequence length 581
Comment pep:known chromosome:MMUL_1:15:37380219:37423255:-1 gene:ENSMMUG00000019561 transcript:ENSMMUT00000027480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWGRTARRRCPRGLRRGREALLVLLALLALAGLGSVLRARRGARARAADPGPPRTPRLGR
REPVLPRPPVPANALGARGEAVRLQLQGEELRLQEESVRLHQINIYLSDRISLHRRLPER
WNPLCKEKKYDYDNLPRTSVIIAFYNEAWSTLLRTVYSVLETSPDILLEEVILVDDYSDR
EHLKERLANELSGLPKVRLIRANKREGLVRARLLGASAARGDVLTFLDCHCECHEGWLEP
LLQRIHEEESAVVCPVIDVIDWNTFEYLGNSGEPQIGGFDWRLVFTWHTVPERERIRMRS
PVDVIRSPTMAGGLFAVSKKYFEYLGSYDTGMEVWGGENLEFSFRIWQCGGVLETHPCSH
VGHVFPKQAPYSRNKALANSVRAAEVWMDEFKELYYHRNPHARLEPFGDVTERKQLRAKL
QCKDFKWFLETVYPELHVPEDRPGFFGMLQNQGLKDYCFDYNPPDENQIVGHQVILYVCH
GMGHNQFFEYTSQKEIRYNTHQPEGCIAVEAGMDILIMHLCEETAPENQKFILQEDGSLF
HEQSKKCVQAARKESSDSFVPLLRDCTNSDHQKWFFKERML
Download sequence
Identical sequences F7BMV2
ENSMMUP00000025703 NP_001181506.1.72884 9544.ENSMMUP00000025703 ENSMMUP00000025703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]