SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025745 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025745
Domain Number 1 Region: 317-597
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.77e-70
Family Tandem AAA-ATPase domain 0.0000804
Further Details:      
 
Domain Number 2 Region: 66-140
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000394
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025745   Gene: ENSMMUG00000019599   Transcript: ENSMMUT00000027527
Sequence length 648
Comment pep:known chromosome:MMUL_1:4:69632939:69654996:1 gene:ENSMMUG00000019599 transcript:ENSMMUT00000027527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHHGGTPKASTWVVASRRSSTVPRAPERRPVEELNRRGPEGYSVGRGSRWRGPCRPPEA
VAAGHEEPPLCFALKNHFVGAVIGRGGSKIKNIQSTTNTTIQIIQEQPESLVKIFGSKAM
QTKAKAAIDNFVKKLEENYNSECGVDTAFQPSVGKDRSTDNNVVAGDRPLIDWDQIREEG
LKWQKTKWADLPPIKKNFYKESTATSAMSKVQADSWRKENFNITWDDLKDGEKRTIPNPT
CTFDDAFQCYPEVMENIKKAGFQKPTPIQSQAWPIVLQGIDLIGVAQTGTGKTLCYLMPG
FIHLDLQPTLKGQRNRPGMLVLTPTRELALQVEGECCKYSYKGLRSVCVYGGGNRDEQIE
ELRKGVDIIIATPGRLNDLQMNNFVNLKNITYLVLDEADKMLDMGFEPQIMKILLDVRPD
RQTVMTSATWPHSVHRLAQSYLKEPMIVYVGTLDLVAVSSVKQNIIVTTEEEKWSHMHTF
LQNMSSTDKVIVFVSRKAVADHLSSDLILGNISIESLHGDREQRDREKALENFKTGKVRI
LIATDLASRGLDVHDVTHVYNFDFPRNIEEYVHRIGRTGRAGRTGVSITTLTRNDWRVAS
ELINILERANQSIPEELVSMAERFKAHQQKREMERKMERPQGRPKKFH
Download sequence
Identical sequences A0A2K5VDJ5 F7B8M1
XP_001112413.1.72884 XP_005552613.1.63531 ENSMMUP00000025745 ENSMMUP00000025745 9544.ENSMMUP00000025745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]