SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025776 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025776
Domain Number 1 Region: 29-356
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.43e-101
Family Glycosyl hydrolases family 35 catalytic domain 0.0001
Further Details:      
 
Domain Number 2 Region: 474-632
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.11e-31
Family Beta-galactosidase LacA, domains 4 and 5 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025776   Gene: ENSMMUG00000019624   Transcript: ENSMMUT00000027561
Sequence length 654
Comment pep:known chromosome:MMUL_1:12:83091182:83098502:-1 gene:ENSMMUG00000019624 transcript:ENSMMUT00000027561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPKKPSCLRSLLLPLSLTLLLPQADTRSFIVDRDHDRFLLDGAPFRYVSGSLHYFRVPR
VLWADRLLKMRWSGLNAIQFYVPWNYHEPQPGVYNFNGSRDLIAFLNEAALANLLVILRP
GPYICAEWEMGGLPSWLLRKPEIRLRTSDPDFLAAVDSWFKVLLPKIYPWLYHNGGNIIS
IQVENEYGSYGACDFSYMRHLAGLFRALLGEKILLFTTDGPEGLKCGSLQGLYTTVDFGP
ADNMTKIFTLLRKYEPHGPLVNSEYYTGWLDYWGQNHSTRSVSAVTKGLENMLKLGASVN
MYMFHGGTNFGYWNGADKKGRFLSITTSYDYDAPISEAGDPTPKLFALRDVISKFQEVPL
GPLPPPSPKMMVGPLTLHLVGHLLAFLDLLCPSGPIRSILPMTFEAVKQDRGFMLYRTYM
THTIFEPTPFWVPNNGVHDRAYVMVDGVFQGVLERNMRDKLFLMGKVGSKLDILVENMGR
LSFGSNSSDFKGLLEPPILGQTILTQWMMFPLKIDNLVKWWFLLQLPKWPYPQAPSGPTF
YSKTFPILGSVGDTFLHLPGWTKGQVWINGFNLGRYWTKRGPQQTLYVPRFLLFPRGALN
KITLLELENVPLQPQVQFLDKPILNSTSTLHRTHINSLSADTLSASEPVELSGH
Download sequence
Identical sequences F7B194
ENSMMUP00000025776 XP_001098786.1.72884 XP_014966600.1.72884 ENSMMUP00000025776 9544.ENSMMUP00000025776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]