SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025827 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025827
Domain Number 1 Region: 5-208
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 7.01e-33
Family Ccg1/TafII250-interacting factor B (Cib) 0.00000000928
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025827   Gene: ENSMMUG00000019657   Transcript: ENSMMUT00000027614
Sequence length 210
Comment pep:known chromosome:MMUL_1:2:84423627:84429097:1 gene:ENSMMUG00000019657 transcript:ENSMMUT00000027614 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASVEQHEGTIQVQGQALFFREARPSSGQAHFSVLLLHGIRFSSETWQNLGTLHRLAQA
GYQAVAIDLPGLGHSKEAAAPVPIGELAPGSFLAAVVDALELGPPVVISPSLSGMYSLPF
LTAPGSQLRGYVPVAPICTDKINAANYASVKTPALIVYGDQDPMGQSSFEHLKQLPNHRV
LIMKGAGHPCYLDKPEEWHTGLLDFLQGLQ
Download sequence
Identical sequences H9ZEI0
ENSMMUP00000025827 ENSMMUP00000025827 NP_001165336.1.72884 XP_014986035.1.72884 9544.ENSMMUP00000025827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]