SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025831 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025831
Domain Number 1 Region: 77-269
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 5.05e-32
Family Ccg1/TafII250-interacting factor B (Cib) 0.0000229
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025831   Gene: ENSMMUG00000019658   Transcript: ENSMMUT00000027618
Sequence length 271
Comment pep:known chromosome:MMUL_1:2:84416415:84422571:-1 gene:ENSMMUG00000019658 transcript:ENSMMUT00000027618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGALCGCWFRLGGARPLIPFGPTVVQTSMSRSQVALLGLGLLLIFLLYVGLPGPPEQNS
WFWGDPNVTVLAGLTPGNSPIFYREVLPLNPAHRVEVVLLHGKAFNSHTWEQLGTLQLLS
QRGYRAVALDLPGFGNSAPSKEASTEAGRAALLERALQDLEVQNAVLVSPSLSGHYALPF
LMRGHHQLHGFVPIAPTSTQNYTQEQFWAVKTPTLILYGELDHILARESLRQLRHLPNHS
VVKLRNAGHACYLHKPQDFHLVLLAFLDHLP
Download sequence
Identical sequences A0A1D5QWH3 A0A2I3N646
XP_014986254.1.72884 9544.ENSMMUP00000025831 ENSMMUP00000025831 ENSMMUP00000025831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]