SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025967 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000025967
Domain Number - Region: 35-131
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0251
Family BAR domain 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025967   Gene: ENSMMUG00000019750   Transcript: ENSMMUT00000027758
Sequence length 401
Comment pep:known chromosome:MMUL_1:14:64482626:64508503:-1 gene:ENSMMUG00000019750 transcript:ENSMMUT00000027758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMVALRGASALLVLFLAAFLPPPQCAQDPAMVHYIYQRFRVLEQGLEKCTQATRAYIQEF
QEFSKNISVMLGRCQTYTSEYKSAVGNLALRVERAQREIDYIQYLREADECIESEDKTLA
ETLLQEAEEEKKIRTLLNASCDNMLMSIKSLKIVKKMMDTHGSWMKDAVYNSPKVYLLIG
SRNNTVWEFANIRAFMEDNTKPAPRKQILTLSWQGTGQVIYKGFLFFHNQATSNEIIKYN
LQKRTVEDRMLLPGGVGRALVYQHSPSTYIDLAVDEHGLWAIHSGPGTHSHLVLTKIEPG
TLGVEHSWDTPCRSQDAEASFLLCGVLYVVYRTGGQGPHRITCVYDPLGTISEEDLPNLF
FPKRPSHSMIHYNPRDKQLYAWNEGNQIIYKLQTKRKLPLK
Download sequence
Identical sequences ENSMMUP00000025967 ENSMMUP00000025967 9544.ENSMMUP00000025967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]