SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026027 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026027
Domain Number 1 Region: 34-245
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.78e-63
Family SPRY domain 0.0000000171
Further Details:      
 
Domain Number 2 Region: 235-272
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000123
Family SOCS box-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026027   Gene: ENSMMUG00000019796   Transcript: ENSMMUT00000027821
Sequence length 273
Comment pep:known chromosome:MMUL_1:2:146691858:146779803:-1 gene:ENSMMUG00000019796 transcript:ENSMMUT00000027821 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQKLSGSLKSVEVREPALRPAKRELRGAEPGRPARLDQLLDMPAAGLAVQLRHAWNPED
RSLNVFVKDDDRLTFHRHPVAQSTDGIRGKVGHARGLHAWQINWPARQRGTHAVVGVATA
RAPLHSVGYTALVGSDAESWGWDLGRSRLYHDGKNQPGVAYPAFLGPDEAFALPDSLLVV
LDMDEGTLSFIVDGQYLGVAFRGLKGKKLYPVVSAVWGHCEVTMRYINGLDPEPLPLMDL
CRRSVRSALGRQRLRDISSLPLPQSLKNYLQYQ
Download sequence
Identical sequences A0A2K5VXF6 F7G521
9544.ENSMMUP00000026027 ENSMMUP00000026027 XP_005545998.1.63531 XP_014987486.1.72884 XP_015300634.1.63531 ENSMMUP00000026027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]