SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026051 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026051
Domain Number 1 Region: 1913-2213
Classification Level Classification E-value
Superfamily BEACH domain 5.49e-103
Family BEACH domain 0.0000000297
Further Details:      
 
Domain Number 2 Region: 2331-2593
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.12e-28
Family WD40-repeat 0.0032
Further Details:      
 
Domain Number 3 Region: 1786-1872
Classification Level Classification E-value
Superfamily PH domain-like 9.84e-20
Family PreBEACH PH-like domain 0.0059
Further Details:      
 
Domain Number 4 Region: 585-735
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000043
Family Laminin G-like module 0.057
Further Details:      
 
Domain Number 5 Region: 322-346,379-509
Classification Level Classification E-value
Superfamily ARM repeat 0.0000019
Family HspBP1 domain 0.074
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000026051
Domain Number - Region: 820-834,887-904,932-1078,1112-1185,1240-1281
Classification Level Classification E-value
Superfamily ARM repeat 0.0299
Family Armadillo repeat 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026051   Gene: ENSMMUG00000019813   Transcript: ENSMMUT00000027846
Sequence length 2622
Comment pep:known chromosome:MMUL_1:2:89531833:89561145:-1 gene:ENSMMUG00000019813 transcript:ENSMMUT00000027846 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EPGRAMAASERLYELWLLYYAQKDLGYLQQWLKAFVGAFKKSISLSSLEPRRPEEAGAEV
PLLPLDALHVLAEQLHQADLEQALLLLKLFIILCRNLENIEAGRGQVLVPRVLALLTKLV
AELKGCPPPQDQGAQLENVALHALLLCEGLFDPYQTWRRQRSGEVISSKEKSKYKFPPAA
LPQEFSAFFQESLQNADHLPPILLLRLIHLFCAVLAGGKENGQMAVSDGSVKGLLSVVRG
WSHGPAPDPHLVPLALEALVGAVHVLHASRTPPRGPELRALLESYFHVLNADWPAGLSSG
PEEALVTLRVSMLDAIPMMLACEDRPVLQATFLSNNCFEHLTRLIQNSKLYLQARAPPEG
DSDLATRLLTEPNVQKVLDQDTDAIAVHVVRVLTCIMNDSPSAKEVFKERIGYPHLQEVL
QSHGPPTHRLLQELLNMAVEGDHSLCPPPPIRNEQPILVLVQWLPSLPTAELRLFLAQRL
RWLCDSCPASRATCVQAGLVGCLLETLSTGLALEARCQEQLLALLQALGRVSIRPMELRH
LLRPPPGLDSGPGGAEAGKARHAGAVIRSLSGMARHQGPARALRYFDLTPSMAGIMVPPV
QRWPGPGFTFHAWLCLHPMDIAPTPAPTRPLQRKQLYSFFTSSGSGFEAFFTAAGTLVVA
VCTRKEYLTMSLPEVSFADSAWHCVAIVHVPGRRPFSQNLVHVYKDGHLVKTAPLRCPSL
SEPFSSCCIGSAGHRTTTTTTGLPMPPVPATLAYTHPTLTRSQSVPASTGLGWGSGLVAP
LQEGSIDSTLAGTQDTRWGSPTSLEGELGTVAIFHEALQATALWTLCTLGPNETAPFKPE
GELHELSTRLLLHYSPQACKNNICLDLSPSHGLDGRLTGHRVETWDVKDVVNCVGGMGAL
LPLLERVAAQPKEAEASPAETHDLVGPELTSGHKTQGLVLPLGKSSEERMERNAVAAFLL
MLRNFLQGHVVNQESLAQCQGPAIIGALLRKVPSWAMDMNVLMSAQLLMEQVAAEGSGPL
LYLLYQHLLFNFHLWTLSDFAVRLGHIQYMSSIVREHRQKLRKKYGVQFILDALRTHYRR
PVGPDGPWGADADTVGEGEAWVRGAWGPWHQCETLHPQVVGALDLLLALLHGSLAQESLA
IFLLEPGNLEVLLALLVRPGSLPLLPDRVCKILRRLQQNERLPERSRQRLRLRECGLQGL
IACLPEGTVSPQLCQGLYKLFLGADCLNLSDLLAVVQLSLQADLSVRLDICRQLFHLIYG
QPDIVRLLARQAGWQDVLTRLYVLEAATAGSPPPSSPESPTSPKPAPPKPPTESPAEPSD
VFLPSEAPCPDPDGFYHALSPFCMPFDLGLERSSVGSGNTAGGGGGSSGTLTPASQPGTP
SPLDGPRPFSAAPGRHSSSLSNVLEDGSLPEPTISGDDTSNTSNPQQTSEEELCNLLTNV
LFSVTWRGVEGSDEAAWRERGQVFSVLTQLGASATLVRPPDCIKRSLLEMMLESALTDIK
EAPVGVLASLTQQVLWLLRLLQDFLCAEGHGNQELWSEKLFEGVCSLLDRLGAWPHLANG
TADLREMAQIGLRLVLGYILLEDPQLHAQAYVRLHMLLQTAVPDRREEACYMSHKVEKRG
RTGSSQGTDLSPPPQELVLEPAQRRARLEGLRYAAALKQQAAQHSTALLHWGTLWRQLTS
PCGAWALRDPPTLRWKLSSAETYSRMRLKLVPNHHFDPHLEASALRDNLGEVPLTPTEEA
SLPLAVTKEAKVSTPPEELQEDQLGEDELAELETPMEAAELDEQREKLVLSAECQLVTVV
AVVPGLLEVTTQNVYFYDGSTERVETEEGIGYDFRRPLAQLREVHLRRFNLRRSALELFF
IDQANYFLNFPCKVGTTPASSPSQTPRPQPGPIPPHTQVRNQVYSWLLRLRPPSQGYLSS
RSPQEMLRASGLTQKWVQREISNFEYLMQLNTIAGRTYNDLSQYPVFPWVLQDYVSPTLD
LSNPAVFRDLSKPIGVVNPKHAQLVREKYESFEDPAGTIDKFHYGTHYSNAAGVMHYLIR
VEPFTSLHVQLQSGRFDCSDRQFHSVAAAWQARLESPADVKELIPEFFYFPDFLENQNGR
REVLALEQAGKWQAAGVLKVMGVSRPALIAAPYSQESEYVSAHLHEWIDLIFGYKQRGPA
AEEALNVFYYCTYEGAVDLDHVTDERERKALEGIISNFGQTPCQLLKEPHPTRLSAEEAA
HRLARLDTNSPSIFQHLDQLKAFFAEVVSDGVPLVLALVPHRQPHSFITQGSPDLLVTVS
ASGLLGTHSWLPYDRNISNYFSFSKDPTMGSHKTQRLLSGPWVPDSGVSGQALAVAPDGK
LLFSGGHWDGSLRVTALSRGKLLSQLSRHLDVVTCLALDTCGIYLISGSRDTTCMVWRLL
HQGGLSVGLAPKPVQVLYGHGAAVSCVAINTELDMAVSGSEDGAVIIHTVRRGQFVAALQ
PPSASVPGPIFHLALGSEGQIVVQSSAWERPGAQVTYSLHLYSVNGKLRASLPLAEQPTA
LTVTEDFVLLGTAQCALHILQLNTLLPAAPPLPMKVAIRSVAVTKERSHVLVGLEDGKLI
VVGAGQPSEVRSSQFARKLWRSARRISQVSSGETEYNPAEAR
Download sequence
Identical sequences 9544.ENSMMUP00000026051 ENSMMUP00000026051 ENSMMUP00000026051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]