SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026085 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026085
Domain Number 1 Region: 263-463
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 2.05e-96
Family N-acetyl transferase, NAT 0.000000168
Further Details:      
 
Domain Number 2 Region: 34-151
Classification Level Classification E-value
Superfamily Chromo domain-like 2.33e-22
Family Chromo barrel domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026085   Gene: ENSMMUG00000019839   Transcript: ENSMMUT00000027881
Sequence length 474
Comment pep:known chromosome:MMUL_1:14:8703840:8712207:-1 gene:ENSMMUG00000019839 transcript:ENSMMUT00000027881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEVVSPVPGAGRREPGEVGRARGPPVADPGAALSPQGEIIEGCRLPVLRRNQDNEDEWP
LAEILSVKDISGRKLFYVHYIDFNKRLDEWVTHERLDLKKIQFPKKEAKTPTKNGLPGSR
PGSPEREVPASAQASGKTLPIPVQITLRFNLPKEREAIPGGEPDQPLSSSSCLQPNHRST
KRKVEVVSPATPVPSETAPASVFPQNGAARRAVAAQPGRKRKSNCLGTDEDSQDSSDGIP
SAPRMTGSLVSDRSHDDIVTRMKNIECIELGRHRLKPWYFSPYPQELTTLPVLYLCEFCL
KYGRSLKCLQRHLTKCDLRHPPGNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHK
TLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIE
FSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEILMGLKSESGERPQITI
Download sequence
Identical sequences ENSMMUP00000026085 9544.ENSMMUP00000026085 ENSMMUP00000026085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]