SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026131 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026131
Domain Number 1 Region: 405-461
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000392
Family TSP-1 type 1 repeat 0.00033
Further Details:      
 
Domain Number 2 Region: 466-516
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000732
Family TSP-1 type 1 repeat 0.00074
Further Details:      
 
Domain Number 3 Region: 519-574
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000051
Family TSP-1 type 1 repeat 0.0004
Further Details:      
 
Domain Number 4 Region: 353-402
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000327
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Domain Number 5 Region: 261-314
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000209
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000026131
Domain Number - Region: 591-638
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.00034
Family Hormone receptor domain 0.006
Further Details:      
 
Domain Number - Region: 946-1122
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00076
Family Rhodopsin-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026131   Gene: ENSMMUG00000019877   Transcript: ENSMMUT00000027931
Sequence length 1570
Comment pep:known chromosome:MMUL_1:8:144991004:145074280:1 gene:ENSMMUG00000019877 transcript:ENSMMUT00000027931 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGQAAAPGPVWILAPLLLLLLLLGRRARAAAGADAGPGPEPCATLVQGKFFGYFSAAAV
FPANASRCSWTLRNPDPRRYTLYMKVVKAPVPCSGPGRVRTYQFDSFLESTRTYLGVESF
DEVLRLCDPSAPLAFLQASKQFLQMRRQQPPQDDELGPRVGPPGPSDDFSVEYLVVGNRN
PSRAACQMLCRWLDACLAGSRSSHPCGIMQTPCACLGGEAGGPAAGPLTPRGDVCLRDAV
AGGPENCLTSLTQDRGGHSATGGWKLWSLWGECTRDCGGGLQTRTRTCLPVPGVEGGGCE
GVLEEGRQCNREACGPAGRTSSRSQSLRSTDARRREELGDELQQFGFPAPQTGDPAAEEW
SPWSVCSSTCGEGWQTRTRFCVSSSYSTQCSGPLREQRLCNNSAVCPVHGAWDEWSPWSL
CSSTCGRGFRDRTRTCRPPQFGGNPCEGPEKQTKFCNIALCPERRVDGNWNEWSSWSACS
ASCSQGRQQRTRECNGPSYGGAECQGHWVETRDCFLQQCPVDGKWQAWASWGSCSVTCGA
GSQRRERVCSGPFFGGAVCQGPQDEYRQCGTQRCPEPHEICDEDNFGAVIWKETPAGEVA
AVRCPRNATGLILRRCELDEEGIAYWEPPTYIRCVSIDYRNIQMMTREHLAKAQRGLPGE
GVSEVIQTLVEISQDGTSYSGDLLSTIDVLRNMTEIFRRAYYSPTPGDVQNFVQILSNLL
AEENRDKWEEAQLAGPNAKELFRLVEDFVDVIGFRMKDLRDAYQVTDNLVLSIHKLPASG
ATDISFPMKGWRATGDWAKVPEDRVTVSKSVFSTGLAEADEASVFVVGTVLYRNLGSFLA
LQRNTTVLNSKVISVTVKPPPRSLRTPLEIEFAHMYNGTTNQTCILWDETDVPSSSAPPQ
LGPWSWRGCRTVPLDALRTRCLCDRLSTFAILAQLSADANMEKATLPSVTLIVGCGVSSL
TLLMLVIIYVSVWRYIRSERSVILINFCLSIISSNALILIGQTQTRNKVVCTLVAAFLHF
FFLSSFCWVLTEAWQSYMAVTGHLRNRLIRKRFLCLGWGLPALVVAISVGFTKAKGYSTM
NYCWLSLEGGLLYAFVGPAAAVVLVNMVIGILVFNKLVSKDGITDKKLKERAGASLWSSC
VVLPLLALTWMSAVLAVTDRRSALFQILFAVFDSLEGFVIVMVHCILRREVQDAVKCRVV
DRQEEGNGDSGGSFQNGHAQLMTDFEKDVDLACRSVLNKDIAACRTATITGTLKRPSLPE
EEKLKLAHAKGPPTNFNSLPANVSKLHLHGSPRYPGGPLPDFPNHSLTLKRDKAPKSSFV
GDGDIFKKLDSELSRAQEKALDTSYVILPTATATLRPKPKEEPKYSIHIDQMPQTRLIHL
STAPEATLPARSPPSRQAPTGGAASVRPQACPPGLAPESRDEMSKSLMPQCQAGRGVDLS
GDFRDPWRMFTNPFSLQRRKSRYAELDFEKIMHTRKRHQDMFQDLNRKLQHAAEKDKEVL
GPDSKPEKQQTPNKRPWESLRKAHGTPTWVKKELEPLQPSPLELRSVEWERSGATIPLVG
QDIIDLQTEV
Download sequence
Identical sequences ENSMMUP00000026131 ENSMMUP00000026131 9544.ENSMMUP00000026131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]