SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026136 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026136
Domain Number 1 Region: 1-39
Classification Level Classification E-value
Superfamily Chromo domain-like 0.00000000000000323
Family Chromo domain 0.00026
Further Details:      
 
Domain Number 2 Region: 91-140
Classification Level Classification E-value
Superfamily Chromo domain-like 0.00000042
Family Chromo domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026136   Gene: ENSMMUG00000019882   Transcript: ENSMMUT00000027937
Sequence length 154
Comment pep:known chromosome:MMUL_1:16:32286869:32292802:-1 gene:ENSMMUG00000019882 transcript:ENSMMUT00000027937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSE
DKGEESKPKKKKEESRSRRGFTVLEPLRPATTDSSGELMFLMKWGKELDLRNSNHPSVKL
RWHSPSIVVISFYEERLTWHSYPSEDDDKKDDKN
Download sequence
Identical sequences ENSMMUP00000026136 9544.ENSMMUP00000026136 ENSMMUP00000026136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]