SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026147 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026147
Domain Number 1 Region: 932-1137
Classification Level Classification E-value
Superfamily Fibronectin type III 2.55e-39
Family Fibronectin type III 0.00075
Further Details:      
 
Domain Number 2 Region: 636-826
Classification Level Classification E-value
Superfamily Fibronectin type III 7.62e-37
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 3 Region: 505-603
Classification Level Classification E-value
Superfamily Fibronectin type III 4.77e-24
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 4 Region: 274-369
Classification Level Classification E-value
Superfamily Immunoglobulin 1.67e-19
Family I set domains 0.014
Further Details:      
 
Domain Number 5 Region: 1578-1665
Classification Level Classification E-value
Superfamily Immunoglobulin 2.32e-18
Family I set domains 0.01
Further Details:      
 
Domain Number 6 Region: 416-501
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000136
Family I set domains 0.036
Further Details:      
 
Domain Number 7 Region: 1355-1442
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000162
Family I set domains 0.021
Further Details:      
 
Domain Number 8 Region: 1155-1220
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000318
Family I set domains 0.029
Further Details:      
 
Domain Number 9 Region: 1485-1537
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000549
Family I set domains 0.038
Further Details:      
 
Domain Number 10 Region: 1251-1332
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000366
Family I set domains 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026147   Gene: ENSMMUG00000019892   Transcript: ENSMMUT00000027949
Sequence length 1684
Comment pep:known chromosome:MMUL_1:18:10980054:11099665:1 gene:ENSMMUG00000019892 transcript:ENSMMUT00000027949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLPFYQRSHQHYDFSYRNKDLRTTVSHYQHEKKRSAIYTQGSTAYSSRSSAAHRQEAEA
FRQASAASFQQQASQYALSSDVSRKAASAFDYGSSHGLTDSSLLLDDYSSKLSPKPKRAK
HSLLSGEEKENLPSDYMVPIFSGRQKHVSGITDTEEERIKEAAAYIAQRNLLASEEGITT
SKQSTASKQSTASKQSMTSKQSTASRQXXXXXXXASKQSVVSKQATSTLQQEETFEKKSR
KVAIREKAERLSLRKTLEETEAYHAKLNEDHLLHAPEFIIKPRSHTVWEKENVKLHCSIA
GWPEPRVTWYKNQVPINVHANPGKYIIESRYGMHTLEINACDFEDTAQYRASAMNVKGEL
SAYASVVVKRYKGEFDETRFHAGVSTMPLSFAVTPYGYASKFEIHFDDKFDVSFGREGET
MSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKEDEGLYT
FRVRMGEYYEQYSAYVFVRDADAEIEGAPAAPLDVKCLEANKDYIIISWKQPAVDGGSPI
LGYFIDKCEVGTDNWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKTGIGFPSRVSEP
VAALDPAEKARLKSRPSAPWTGQIIVTEEEPSEGIVPGPPTDLSVTEATRSYVVLSWKPP
RQRGHEGIMYFVEKCEAGTENWQRVNTELPVKSPRFALFDLAEGKSYCFRVRCSNSAGVG
EPSDATEVTVVGDKLDIPKAPGKIIPSRNTDTSVVVSWEESADAKELVGYYIEASVAGSG
KWEPCNNNPVKGSRFTCHGLVTGQSYIFRVRAVNAAGLSEYSQDSEAIEVKAAIGGGVSP
DVCPALSDEPGGLTASRGCVHEASPPIFQKDALLGSKPNKPSLPSSSQNLGQTEVSKVSE
TVQEELTPPPQKAAPQGKSKSDPLKKKTDRAPPSPPHDITCLESFRDSMVLGWKQPDKIG
GAEITGYYVNYREVIDGVPGKWREANVKAVSEEAYKISNLKENMVYQFQVAAMNMAGLGT
PSAVSECFKCEEWTIAVPGPPHSLKCSEVRKDSLVLQWKPPVHSGRTPVTGYFVDLKEAK
AKEDQWRGLNEAAIKNVYLKVRGLKEGVSYVFRVRAINQAGVGKPSDLAGPVVAETRPGT
KEVVVNVDDDGVISLNFECDQMTPKSEFTWSKDYVSTEDSPRLEVESKGNKTKMTFKDLG
MDDLGLYSCDVTDTDGIASSYLIDEEELKRLLALSHEHKFPTVPVKSELAVEILEKGQVR
FWMQAEKLSGNAKVNYIFNEKEIFEGPKYKMHIDRNTGIIEMFMEKLQDEDEGTYTFQLQ
DGKATNHSTVVLIGDVFKKLQKEAEFQRQEWIRKQGPHFAEYLSWEVTGECNVLLKCKVA
NIKKETHIVWYKDEREISVDEKHDFKDGICTLLITEFSKKDAGIYEVILKDDRGKDKSRL
KLVDEAFKELMTEVCKKIALSATDLKIQSTAEGIRLYSFVTYYVEDLKVNWSHNGAAIRY
SDRVKTGVTGEQIWLQINEPTPNDKGKYVMELFDGKTGHQKTVDLSGQAYEEAYAEFQRL
KQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNVWGDPPPEVSWLKNEKALASDDHCNL
KFEAGKTAYFTINGVSTADSGKYGLVVKNKYGSETSDFTVSVFIPEEEARMAALEAQKGG
KKAK
Download sequence
Identical sequences ENSMMUP00000026146 ENSMMUP00000026147 9544.ENSMMUP00000026146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]