SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026256 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026256
Domain Number 1 Region: 460-658
Classification Level Classification E-value
Superfamily Kelch motif 3.14e-62
Family Kelch motif 0.0000143
Further Details:      
 
Domain Number 2 Region: 193-307
Classification Level Classification E-value
Superfamily POZ domain 3.92e-33
Family BTB/POZ domain 0.0018
Further Details:      
 
Domain Number 3 Region: 631-745
Classification Level Classification E-value
Superfamily Kelch motif 3.92e-33
Family Kelch motif 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026256   Gene: ENSMMUG00000019967   Transcript: ENSMMUT00000028064
Sequence length 748
Comment pep:known chromosome:MMUL_1:17:50023641:50462592:-1 gene:ENSMMUG00000019967 transcript:ENSMMUT00000028064 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGSGRKDFDVKHILRLRWKLFSHPSPSTGSPAGGGCLQQDGSGSFEHWGPSQSRLLKSH
ERSGVSTFWKKPSSSSSSSSSPSSSSSSFNPLNGTLLPVATRLQQGAPGQGTQQPARTLF
YVESLEEEVVPGMDFPGPHDKGLVLQELKVEPDSSSQATGEGCGHRLSSTGHSMTPQSDL
DSSSSEEFYQAVHHAEQTFRKMESYLKQQQLCDVILIVGNRKIPAHRLVLSSVSDYFAAM
FTSDVCEAKQEEIKMEGIDPNALWDLVQFAYTGCLELKEDTIENLLAAACLLQLPQVVEV
CCHFLMKLLHPSNCLGIRAFADAQGCIELMKVAHSYTMENIMEVIRNQEFLLLPAEELHK
LLASDDVNVPDEETIFHALMMWVKYDMQSRCNDLSMLLAFIRLPLLPPQILADLENHALF
KNDLECQKLILEAMKYHLLPERRTLMQSPRTKPRKSTVGTLYAVGGMDNNKGATTIEKYD
LRTNLWIQAGMMNGRRLQFGVAVIDDKLFVIGGRDGLKTLNTVECYNPKTKTWTVLPPMS
THRHGLGVTVLEGPIYAVGGHDGWSYLNTVERWDPQSQQWTFVASMSIARSTVGVAALNG
KLYSVGGRDGSSCLSSMEYYDPHTNKWNMCAPMCKRRGGVGVATCDGFLYAVGGHDAPAS
NHCSRLLDYVERYDPKTDTWTMVAPLSMPRDAVGVCLLGDRLYAVGGYDGQTYLNTMESY
DPQTNEWTQMASLNIGRAGACVVVIKQP
Download sequence
Identical sequences A0A2K5MWK2 A0A2K5VSJ9 F7FT23
ENSMMUP00000026256 ENSMMUP00000026256 9544.ENSMMUP00000026256 NP_001182229.1.72884 XP_005586043.1.63531 XP_011933813.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]