SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026294 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026294
Domain Number 1 Region: 200-551
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.51e-122
Family beta-N-acetylhexosaminidase catalytic domain 0.00000000000237
Further Details:      
 
Domain Number 2 Region: 55-199
Classification Level Classification E-value
Superfamily beta-N-acetylhexosaminidase-like domain 9.24e-40
Family beta-N-acetylhexosaminidase domain 0.000000215
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026294   Gene: ENSMMUG00000019997   Transcript: ENSMMUT00000028104
Sequence length 556
Comment pep:known chromosome:MMUL_1:6:70878614:70906035:1 gene:ENSMMUG00000019997 transcript:ENSMMUT00000028104 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELCGLGLPRPPMLLALLLATLLAAMLALLTQVALVVQVAEATRAPGVSAARGPALWPLP
LSVKMTPNLLHLAPENFYISHSPNSTAGPSCTLLEEAFRRYHSYIFGFYKWDHEPAKSQA
TAQLQQLLVSITLQSECDAFPNISSDESYTLLVKEPVAVLKANRVWGALRGLETFSQLVY
QDSCGTFTINESTIIDSPRFPHRGILIDTSRHYLPVKIILKTLDAMAFNKFNVLHWHIVD
DQSFPYQSIAFPELSNKGSYSLSHVYTPNDVRMVIEYARLRGIRVLPEFDTPGHTLSWGK
GQKDLLTPCYSRQNKLDSFGPINPTLNTTYSFLTTFFKEISEVFPDQFIHLGGDEVEFKC
WESNPKIQDFMKQKGFGKDFKKLESFYIQKVLDIIATINKGSIVWQEVFDDKVKLAPGTI
VEVWKDNAYPEELSKVTASGFPVILSAPWYLDLISYGQDWRKYYKVEPLDFGGTREQKQL
FIGGEACLWGEYVDATNLTPRLWPRASAVGERLWSSKDVRDMDGAYDRLTRHRCRMVERG
IAAQPLYAGYCNHENV
Download sequence
Identical sequences A0A2K5WD70 F7FNG8
9544.ENSMMUP00000026294 ENSMMUP00000026294 ENSMMUP00000026294 NP_001253386.1.72884 XP_005557204.1.63531 XP_011728470.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]