SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026326 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026326
Domain Number 1 Region: 4-107
Classification Level Classification E-value
Superfamily t-snare proteins 8.37e-33
Family t-snare proteins 0.00000157
Further Details:      
 
Domain Number 2 Region: 159-225
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.00000000000000113
Family SNARE fusion complex 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026326   Gene: ENSMMUG00000020021   Transcript: ENSMMUT00000028139
Sequence length 255
Comment pep:known chromosome:MMUL_1:1:189696993:189744664:1 gene:ENSMMUG00000020021 transcript:ENSMMUT00000028139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWD
LEDLDETINILFSNPRKFNLDATELSIRKAFITSTRQVVRDMKDQMSTSSVQALAERKNR
QALLGDSGSQNWSTGTADKYGRLDRELQRANSHFIEEQQAQQQLIVEQQDEQLELVSGSI
GVLKNMSQRIGGELEEQAVMLEDFSHELESTQSRLDNVMKKLAKVSHMTSDRRQWCAIAI
LFAVLLVVLILFLVL
Download sequence
Identical sequences G7MF55 G7NXI3
9544.ENSMMUP00000026326 ENSMMUP00000026326 ENSMMUP00000026326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]