SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026348 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026348
Domain Number 1 Region: 34-320
Classification Level Classification E-value
Superfamily Aldolase 2.83e-70
Family Class I aldolase 0.0000272
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026348   Gene: ENSMMUG00000020033   Transcript: ENSMMUT00000028161
Sequence length 322
Comment pep:known chromosome:MMUL_1:9:97165540:97193702:1 gene:ENSMMUG00000020033 transcript:ENSMMUT00000028161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGPQVWSSVRQGLSRSLSRNVRGWASGEGKKVDIAGIYPPVTTPFTATAEVDYGKLEEN
LHKLGTFPFRGFVVQGSNGEFPFLTSSERLEVVSRVRQAMPKNKLLLAGSGCEVSHNALM
AQVGADVAMVVTPCYYRGRMSSAALIHHYTKVADLSPIPVVLYSVPANTGLDLPVDAVVT
LSQHPNIVGMKDSGGDVTRIGLIVHKTRKQDFQVLAGSAGFLMASYALGAVGGVCALANV
LGAQVCQLERLCLTGQWEDAQKLQHRLIEPNAAVTRRFGIPGLKKMMDWFGYYGGPCRAP
LQELSPAEEEALRMDFTSNGWL
Download sequence
Identical sequences 9544.ENSMMUP00000026348 ENSMMUP00000026348 ENSMMUP00000026348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]