SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026374 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026374
Domain Number 1 Region: 1-202
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.1e-76
Family Protein kinases, catalytic subunit 0.0000265
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000026374
Domain Number - Region: 213-264
Classification Level Classification E-value
Superfamily UBA-like 0.0213
Family UBA domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026374   Gene: ENSMMUG00000020050   Transcript: ENSMMUT00000028189
Sequence length 706
Comment pep:known chromosome:MMUL_1:3:3299836:3311808:1 gene:ENSMMUG00000020050 transcript:ENSMMUT00000028189 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLLNHPHIIKLYQVMETKDMLYIVTEFAKNGEMFDYLTSNGHLSENEARKKFWQILSAV
EYCHDHHIVHRDLKTENLLLDGNMDIKLADFGFGNFYKSGEPLSTWCGSPPYAAPEVFEG
KEYEGPQLDIWSLGVVLYVLVCGSLPFDGPNLPTLRQRVLEGRFRIPFFMSQDCESLIRR
MLVVDPARRITIAQIRQHRWMRAEPCLPGPACSTFSAHSYSSNLGDYDEQALGIMQTLGV
DRQRTVESLQNSSYNHFAAIYYLLLERLKEYRNAQCARPGPARQPRPRSSDLSGLEVPQE
GLSTDPFRPALLCPQPQTLVQSVLQAELDCELQSSLQWPLFFPVDASCSGVFRPRPVSPS
SLLDTAISEEARQGPGLEEEQDVQESLPSSTGRRHTLAEVSTRLSPLTAPCIVVSPSASA
SPAEGTSSDSCLTFSASKSPVGLSGTPATQGLLGACSPVRLASPFLGSQSATPVLPTQGG
LGGAVLLPVSFQEGRRASDTSLTQGLKAFRQQLRKTTRTKGFLGLNKIKGLARQMCQAPA
SRASRGGLSPFHAPAQSPGLHGVAAGSREGRSLLEEVLEQQRLLQLQHHPAAAPGCSQAA
QPAPAQFVIAPCDGPGAAPLPSTLLMSGLPLLQPPLLQTGVSPVASAAQLLDTHLHIGAG
PTTLPAAPPPRLARLAPGCEPLGLLQGDCEMEDLTPCPLGTFVLVQ
Download sequence
Identical sequences G7MMI6
ENSMMUP00000026374 ENSMMUP00000026374 9544.ENSMMUP00000026374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]