SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026375 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026375
Domain Number 1 Region: 508-559
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000453
Family PHD domain 0.0000826
Further Details:      
 
Domain Number 2 Region: 92-150
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000121
Family B-box zinc-binding domain 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000026375
Domain Number - Region: 581-686
Classification Level Classification E-value
Superfamily Bromodomain 0.000785
Family Bromodomain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026375   Gene: ENSMMUG00000020051   Transcript: ENSMMUT00000028190
Sequence length 722
Comment pep:known chromosome:MMUL_1:19:64315787:64320998:1 gene:ENSMMUG00000020051 transcript:ENSMMUT00000028190 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVDCPVCKQQCFSKDIVENYFMRDSGSKAATDAQDANQCCTSCEDNAPATSYCVECSEPL
CETCVEAHQRVKYTKDHTVRSTGPAKSRDGERTVYCNVHKHEPLVLFCESCDTLTCRDCQ
LNAHKDHQYQFLEDAVRNQRKLLASLVKRLGDKHATLQKSTKEVRSSIRQVSDVQKRVQV
DVKMAILQIMKELNKRGRVLVNDAQKVTEGQQERLERQHWTMTKIQKHQEHILRFASWAL
ESDNNTALLLSKKLIYFQLHRALKMIVDPVEPHGEMKFQWDLNAWTKSAEAFGKIVAERP
GTNSTGPAPMAPPRAPGPLSKQGSGSSQPMEVQEGYGFGSVDDPYSSAEPHVSGVKRSRS
GEGEVSGLMRKVPRVSLERLDLDLTADSQPPVFKVFPGSTTEDYNLIVIERGAAAAATGQ
PGTAPAGTPGAPPLAGMAIVKEEETEAAIGAPPTATEGPETKPVLMALAEGPGAEGPRLA
SPSGSTSSGLEVVAPEGTSAPGGGPGTLDDSATICRVCQKPGDLVMCNQCEFCFHLDCHL
PALQDVPGEEWSCSLCHVLPDLKEEDGSLSLDGADSTGVVAKLSPANQRKCERVLLALFC
HEPCRPLHQLATDSTFSLDQPGGTLDLTLIRARLQEKLSPPYSSPQEFAQDVGRMFKQFN
KLTEDKADVQSIIGLQRFFETRMNEAFGDTKFSAVLVEPPPMSLPGAGLSSQELSGGPGD
GP
Download sequence
Identical sequences G7PZC7
ENSMMUP00000026375 9544.ENSMMUP00000026375 ENSMMUP00000026375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]